Human SPAG11B/EDDM2B/EP2 ORF/cDNA clone-Lentivirus plasmid (NM_058201)

Cat. No.: pGMLP004899
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SPAG11B/EDDM2B/EP2 Lentiviral expression plasmid for SPAG11B lentivirus packaging, SPAG11B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SPAG11B/EDDM2B products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004899
Gene Name SPAG11B
Accession Number NM_058201
Gene ID 10407
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 402 bp
Gene Alias EDDM2B,EP2,EP2C,EP2D,HE2,HE2C,SPAG11
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGCAACGATTGCTCCCGTCCGTCACCAGCCTTCTCCTTGTGGCCCTGCTGTTTCCAGGATCGTCTCAAGCCAGACATGTGAACCACTCAGCCACTGAGGCTCTCGGAGAACTCAGGGAAAGAGCCCCTGGGCAAGGCACAAACGGGTTTCAGCTGCTACGCCACGCAGTGAAACGGGACCTCTTACCACCGCGCACCCCACCTTACCAAGGGGATGTTCCACCGGGAATTAGAAATACCATCTGCCATATGCAGCAAGGGATCTGCAGACTTTTTTTCTGCCATTCTGGTGAGAAAAAGCGTGACATTTGCTCTGATCCCTGGAATAGGTGTTGCGTATCAAATACAGATGAAGAAGGAAAAGAGAAACCAGAGATGGATGGCAGATCTGGGATCTAA
ORF Protein Sequence MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPYQGDVPPGIRNTICHMQQGICRLFFCHSGEKKRDICSDPWNRCCVSNTDEEGKEKPEMDGRSGI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0624-Ab Anti-SG11B/ SPAG11B/ EDDM2B functional antibody
    Target Antigen GM-Tg-g-SE0624-Ag SPAG11B protein
    ORF Viral Vector pGMLP004899 Human SPAG11B Lentivirus plasmid
    ORF Viral Vector vGMLP004899 Human SPAG11B Lentivirus particle


    Target information

    Target ID GM-SE0624
    Target Name SPAG11B
    Gene ID 10407, 641436
    Gene Symbol and Synonyms EDDM2B,EP2,EP2C,EP2D,EP2L,HE2,HE2C,SPAG11,SPAG11A,SPAG11B
    Uniprot Accession Q08648
    Uniprot Entry Name SG11B_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000164871
    Target Classification Not Available

    This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.