Human SPAG11B/EDDM2B/EP2 ORF/cDNA clone-Lentivirus particle (NM_058201)
Cat. No.: vGMLP004899
Pre-made Human SPAG11B/EDDM2B/EP2 Lentiviral expression plasmid for SPAG11B lentivirus packaging, SPAG11B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SPAG11B/EDDM2B products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004899 | Human SPAG11B Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004899 |
| Gene Name | SPAG11B |
| Accession Number | NM_058201 |
| Gene ID | 10407 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 402 bp |
| Gene Alias | EDDM2B,EP2,EP2C,EP2D,HE2,HE2C,SPAG11 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGGCAACGATTGCTCCCGTCCGTCACCAGCCTTCTCCTTGTGGCCCTGCTGTTTCCAGGATCGTCTCAAGCCAGACATGTGAACCACTCAGCCACTGAGGCTCTCGGAGAACTCAGGGAAAGAGCCCCTGGGCAAGGCACAAACGGGTTTCAGCTGCTACGCCACGCAGTGAAACGGGACCTCTTACCACCGCGCACCCCACCTTACCAAGGGGATGTTCCACCGGGAATTAGAAATACCATCTGCCATATGCAGCAAGGGATCTGCAGACTTTTTTTCTGCCATTCTGGTGAGAAAAAGCGTGACATTTGCTCTGATCCCTGGAATAGGTGTTGCGTATCAAATACAGATGAAGAAGGAAAAGAGAAACCAGAGATGGATGGCAGATCTGGGATCTAA |
| ORF Protein Sequence | MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPYQGDVPPGIRNTICHMQQGICRLFFCHSGEKKRDICSDPWNRCCVSNTDEEGKEKPEMDGRSGI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0624-Ab | Anti-SG11B/ SPAG11B/ EDDM2B functional antibody |
| Target Antigen | GM-Tg-g-SE0624-Ag | SPAG11B protein |
| ORF Viral Vector | pGMLP004899 | Human SPAG11B Lentivirus plasmid |
| ORF Viral Vector | vGMLP004899 | Human SPAG11B Lentivirus particle |
Target information
| Target ID | GM-SE0624 |
| Target Name | SPAG11B |
| Gene ID | 10407, 641436 |
| Gene Symbol and Synonyms | EDDM2B,EP2,EP2C,EP2D,EP2L,HE2,HE2C,SPAG11,SPAG11A,SPAG11B |
| Uniprot Accession | Q08648 |
| Uniprot Entry Name | SG11B_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000164871 |
| Target Classification | Not Available |
This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


