Human RRAD/RAD/RAD1 ORF/cDNA clone-Lentivirus plasmid (NM_004165)

Cat. No.: pGMLP005125
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RRAD/RAD/RAD1 Lentiviral expression plasmid for RRAD lentivirus packaging, RRAD lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RRAD/RAD products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $531.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005125
Gene Name RRAD
Accession Number NM_004165
Gene ID 6236
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 927 bp
Gene Alias RAD,RAD1,REM3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCCTGAACGGCGGCGGCAGCGGAGCGGGCGGGAGCCGCGGTGGGGGCCAGGAGCGCGAGCGCCGTCGGGGCAGCACACCCTGGGGCCCCGCCCCGCCGCTGCACCGCCGCAGCATGCCGGTGGACGAGCGCGACCTGCAGGCGGCGCTGACCCCGGGTGCCCTGACGGCGGCCGCGGCCGGGACGGGGACCCAGGGTCCCAGGCTGGACTGGCCCGAGGACTCCGAGGACTCGCTCAGCTCAGGGGGCAGCGACTCAGACGAGAGCGTTTACAAGGTGCTGCTGCTGGGGGCGCCCGGCGTGGGCAAGAGCGCCCTGGCGCGCATCTTCGGCGGTGTGGAGGACGGGCCTGAAGCAGAGGCAGCAGGGCACACCTATGATCGCTCCATTGTAGTGGACGGAGAAGAGGCATCACTCATGGTCTACGACATTTGGGAGCAGGACGGGGGCCGCTGGTTGCCCGGCCACTGCATGGCCATGGGGGATGCCTATGTCATTGTGTACTCAGTGACGGACAAGGGCAGCTTCGAGAAGGCCTCAGAACTGCGGGTCCAGCTGCGGCGTGCACGGCAAACAGATGATGTGCCCATCATCCTCGTGGGCAACAAGAGCGACCTGGTGCGCTCTCGTGAGGTCTCGGTGGATGAGGGCCGGGCCTGCGCGGTGGTCTTTGACTGCAAGTTCATTGAGACATCAGCGGCATTGCACCACAATGTCCAGGCGCTGTTTGAAGGTGTCGTGCGCCAGATACGCCTGCGCAGGGACAGCAAAGAAGCCAACGCACGACGGCAAGCAGGCACCCGGAGGCGAGAGAGCCTTGGCAAAAAGGCGAAGCGCTTCTTGGGCCGCATCGTAGCTCGTAACAGCCGCAAGATGGCCTTTCGCGCCAAATCCAAGTCCTGCCACGACCTCTCGGTTCTCTAG
ORF Protein Sequence MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2312-Ab Anti-RAD/ RRAD/ RAD1 monoclonal antibody
    Target Antigen GM-Tg-g-MP2312-Ag RRAD VLP (virus-like particle)
    ORF Viral Vector pGMLP005125 Human RRAD Lentivirus plasmid
    ORF Viral Vector vGMLP005125 Human RRAD Lentivirus particle


    Target information

    Target ID GM-MP2312
    Target Name RRAD
    Gene ID 6236, 56437, 695086, 83521, 101087028, 611304, 505165, 100065651
    Gene Symbol and Synonyms RAD,RAD1,REM3,RRAD
    Uniprot Accession P55042
    Uniprot Entry Name RAD_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000166592
    Target Classification Not Available

    Predicted to enable GTP binding activity and calcium channel regulator activity. Predicted to be involved in small GTPase mediated signal transduction. Predicted to be located in cytosol. Predicted to be active in plasma membrane. Implicated in type 2 diabetes mellitus. Biomarker of congestive heart failure. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.