Human WNT7B ORF/cDNA clone-Lentivirus plasmid (NM_058238.2)

Cat. No.: pGMLP005572
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human WNT7B/ Lentiviral expression plasmid for WNT7B lentivirus packaging, WNT7B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to WNT7B/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $594
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005572
Gene Name WNT7B
Accession Number NM_058238.2
Gene ID 7477
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1050 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCACAGAAACTTTCGCAAGTGGATTTTCTACGTGTTTCTCTGCTTTGGCGTCCTGTACGTGAAGCTCGGAGCACTGTCATCCGTGGTGGCCCTGGGAGCCAACATCATCTGCAACAAGATTCCTGGCCTAGCCCCGCGGCAGCGTGCCATCTGCCAGAGTCGGCCCGATGCCATCATTGTGATTGGGGAGGGGGCGCAGATGGGCATCAACGAGTGCCAGTACCAGTTCCGCTTCGGACGCTGGAACTGCTCTGCCCTCGGCGAGAAGACCGTCTTCGGGCAAGAGCTCCGAGTAGGGAGCCGTGAGGCTGCCTTCACGTACGCCATCACCGCGGCTGGCGTGGCGCACGCCGTCACCGCTGCCTGCAGCCAAGGGAACCTGAGCAACTGCGGCTGCGACCGCGAGAAGCAGGGCTACTACAACCAAGCCGAGGGCTGGAAGTGGGGCGGCTGCTCGGCCGACGTGCGTTACGGCATCGACTTCTCCCGGCGCTTCGTGGACGCTCGGGAGATCAAGAAGAACGCGCGGCGCCTCATGAACCTGCATAACAATGAGGCCGGCAGGAAGGTTCTAGAGGACCGGATGCAGCTGGAGTGCAAGTGCCACGGCGTGTCTGGCTCCTGCACCACCAAAACCTGCTGGACCACGCTGCCCAAGTTCCGAGAGGTGGGCCACCTGCTGAAGGAGAAGTACAACGCGGCCGTGCAGGTGGAGGTGGTGCGGGCCAGCCGTCTGCGGCAGCCCACCTTCCTGCGCATCAAACAGCTGCGCAGCTATCAGAAGCCCATGGAGACAGACCTGGTGTACATTGAGAAGTCGCCCAACTACTGCGAGGAGGACGCGGCCACGGGCAGCGTGGGCACGCAGGGCCGTCTCTGCAACCGCACGTCGCCCGGCGCGGACGGCTGTGACACCATGTGCTGCGGCCGAGGCTACAACACCCACCAGTACACCAAGGTGTGGCAGTGCAACTGCAAATTCCACTGGTGCTGCTTCGTCAAGTGCAACACCTGCAGCGAGCGCACCGAGGTCTTCACCTGCAAGTGA
ORF Protein Sequence MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1939-Ab Anti-WNT7B monoclonal antibody
    Target Antigen GM-Tg-g-MP1939-Ag WNT7B VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-MP1939 wingless-type MMTV integration site family, member 7B (WNT7B) protein & antibody
    ORF Viral Vector pGMLP005572 Human WNT7B Lentivirus plasmid
    ORF Viral Vector pGMPC000004 Human WNT7B Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005572 Human WNT7B Lentivirus particle


    Target information

    Target ID GM-MP1939
    Target Name WNT7B
    Gene ID 7477, 22422, 713864, 315196, 101095592, 481206, 100337066, 100053027
    Gene Symbol and Synonyms Wnt-7b,WNT7B
    Uniprot Accession P56706
    Uniprot Entry Name WNT7B_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000188064
    Target Classification Not Available

    This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. [provided by RefSeq, Oct 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.