Human WNT7B ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_058238.2)
Cat. No.: pGMPC000004
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human WNT7B/ Non-Viral expression plasmid (overexpression vector) for mouse WNT7B overexpression in unique cell transient transfection and stable cell line development.
Go to
WNT7B/0 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC000004 |
Gene Name | WNT7B |
Accession Number | NM_058238.2 |
Gene ID | 7477 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 1050 bp |
Gene Alias | 0 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | Null |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCACAGAAACTTTCGCAAGTGGATTTTCTACGTGTTTCTCTGCTTTGGCGTCCTGTACGTGAAGCTCGGAGCACTGTCATCCGTGGTGGCCCTGGGAGCCAACATCATCTGCAACAAGATTCCTGGCCTAGCCCCGCGGCAGCGTGCCATCTGCCAGAGTCGGCCCGATGCCATCATTGTGATTGGGGAGGGGGCGCAGATGGGCATCAACGAGTGCCAGTACCAGTTCCGCTTCGGACGCTGGAACTGCTCTGCCCTCGGCGAGAAGACCGTCTTCGGGCAAGAGCTCCGAGTAGGGAGCCGTGAGGCTGCCTTCACGTACGCCATCACCGCGGCTGGCGTGGCGCACGCCGTCACCGCTGCCTGCAGCCAAGGGAACCTGAGCAACTGCGGCTGCGACCGCGAGAAGCAGGGCTACTACAACCAAGCCGAGGGCTGGAAGTGGGGCGGCTGCTCGGCCGACGTGCGTTACGGCATCGACTTCTCCCGGCGCTTCGTGGACGCTCGGGAGATCAAGAAGAACGCGCGGCGCCTCATGAACCTGCATAACAATGAGGCCGGCAGGAAGGTTCTAGAGGACCGGATGCAGCTGGAGTGCAAGTGCCACGGCGTGTCTGGCTCCTGCACCACCAAAACCTGCTGGACCACGCTGCCCAAGTTCCGAGAGGTGGGCCACCTGCTGAAGGAGAAGTACAACGCGGCCGTGCAGGTGGAGGTGGTGCGGGCCAGCCGTCTGCGGCAGCCCACCTTCCTGCGCATCAAACAGCTGCGCAGCTATCAGAAGCCCATGGAGACAGACCTGGTGTACATTGAGAAGTCGCCCAACTACTGCGAGGAGGACGCGGCCACGGGCAGCGTGGGCACGCAGGGCCGTCTCTGCAACCGCACGTCGCCCGGCGCGGACGGCTGTGACACCATGTGCTGCGGCCGAGGCTACAACACCCACCAGTACACCAAGGTGTGGCAGTGCAACTGCAAATTCCACTGGTGCTGCTTCGTCAAGTGCAACACCTGCAGCGAGCGCACCGAGGTCTTCACCTGCAAGTGA |
ORF Protein Sequence | MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP1939-Ab | Anti-WNT7B monoclonal antibody |
Target Antigen | GM-Tg-g-MP1939-Ag | WNT7B VLP (virus-like particle) |
Cytokine | cks-Tg-g-GM-MP1939 | wingless-type MMTV integration site family, member 7B (WNT7B) protein & antibody |
ORF Viral Vector | pGMLP005572 | Human WNT7B Lentivirus plasmid |
ORF Viral Vector | pGMPC000004 | Human WNT7B Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP005572 | Human WNT7B Lentivirus particle |
Target information
Target ID | GM-MP1939 |
Target Name | WNT7B |
Gene ID | 7477, 22422, 713864, 315196, 101095592, 481206, 100337066, 100053027 |
Gene Symbol and Synonyms | Wnt-7b,WNT7B |
Uniprot Accession | P56706 |
Uniprot Entry Name | WNT7B_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000188064 |
Target Classification | Not Available |
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. [provided by RefSeq, Oct 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.