Human WNT8B ORF/cDNA clone-Lentivirus plasmid (NM_003393.3)

Cat. No.: pGMLP005574
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human WNT8B/ Lentiviral expression plasmid for WNT8B lentivirus packaging, WNT8B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to WNT8B/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $595.68
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005574
Gene Name WNT8B
Accession Number NM_003393.3
Gene ID 7479
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1056 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTTCTTTCAAAGCCTTCTGTGTACATCTGTCTTTTCACCTGTGTCCTCCAACTCAGCCACAGCTGGTCGGTGAACAATTTCCTGATGACTGGTCCAAAGGCTTACCTGATTTACTCCAGCAGTGTGGCAGCTGGTGCCCAGAGTGGTATTGAAGAATGCAAGTATCAGTTTGCCTGGGACCGCTGGAACTGCCCTGAGAGAGCCCTGCAGCTGTCCAGCCATGGTGGGCTTCGCAGTGCCAATCGGGAGACAGCATTTGTGCATGCCATCAGTTCTGCTGGAGTCATGTACACCCTGACTAGAAACTGCAGCCTTGGAGATTTTGATAACTGTGGCTGTGATGACTCCCGCAACGGGCAACTGGGGGGACAAGGCTGGCTGTGGGGAGGCTGCAGTGACAATGTGGGCTTCGGAGAGGCGATTTCCAAGCAGTTTGTCGATGCCCTGGAAACAGGACAGGATGCACGGGCAGCCATGAACCTGCACAACAACGAGGCTGGCCGCAAGGCGGTGAAGGGCACCATGAAACGCACGTGCAAGTGCCACGGCGTGTCTGGCAGCTGCACCACGCAGACCTGTTGGCTGCAGCTGCCCGAGTTCCGCGAGGTGGGCGCGCACCTGAAGGAGAAGTACCACGCAGCACTCAAGGTGGACCTGCTGCAGGGTGCTGGCAACAGCGCGGCCGGCCGCGGCGCCATCGCCGACACCTTTCGCTCCATCTCTACCCGGGAGCTGGTGCACCTGGAGGACTCCCCGGACTACTGCCTGGAGAACAAAACGCTAGGGCTGCTGGGCACCGAAGGCCGAGAGTGCCTAAGGCGCGGGCGGGCCCTGGGTCGCTGGGAACGCCGCAGCTGCCGCCGGCTCTGCGGGGACTGCGGGCTGGCGGTGGAGGAGCGCCGGGCCGAGACCGTGTCCAGCTGCAACTGCAAGTTCCACTGGTGCTGCGCAGTCCGCTGCGAGCAGTGCCGCCGGAGGGTCACCAAGTACTTCTGTAGCCGCGCAGAGCGGCCGCGGGGGGGCGCTGCGCACAAACCCGGGAGAAAACCCTAA
ORF Protein Sequence MFLSKPSVYICLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1385-Ab Anti-WNT8B functional antibody
    Target Antigen GM-Tg-g-SE1385-Ag WNT8B protein
    Cytokine cks-Tg-g-GM-SE1385 wingless-type MMTV integration site family, member 8B (WNT8B) protein & antibody
    ORF Viral Vector pGMLP005574 Human WNT8B Lentivirus plasmid
    ORF Viral Vector vGMLP005574 Human WNT8B Lentivirus particle


    Target information

    Target ID GM-SE1385
    Target Name WNT8B
    Gene ID 7479, 22423, 710242, 293990, 101096357, 486841, 538720, 100070360
    Gene Symbol and Synonyms WNT8B
    Uniprot Accession Q93098
    Uniprot Entry Name WNT8B_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000075290
    Target Classification Not Available

    The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 95%, 86% and 71% amino acid identity to the mouse, zebrafish and Xenopus Wnt8B proteins, respectively. The expression patterns of the human and mouse genes appear identical and are restricted to the developing brain. The chromosomal location of this gene to 10q24 suggests it as a candidate gene for partial epilepsy.



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.