Human SPRY3/spry-3 ORF/cDNA clone-Lentivirus plasmid (NM_001304990.1)

Cat. No.: pGMLP005605
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SPRY3/spry-3 Lentiviral expression plasmid for SPRY3 lentivirus packaging, SPRY3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SPRY3/spry-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $516.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005605
Gene Name SPRY3
Accession Number NM_001304990.1
Gene ID 10251
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 867 bp
Gene Alias spry-3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATGCTGCGGTGACAGATGATTTTCAACAAATTCTGCCTATTGAACAGCTGCGCTCTACTCATGCTAGCAATGACTACGTGGAACGGCCTCCAGCCCCCTGTAAACAGGCCCTCTCCAGCCCTTCCCTTATTGTGCAAACCCACAAGTCTGATTGGTCTCTGGCTACCATGCCTACTTCTCTCCCCCGCAGTCTCAGCCAGTGCCATCAACTGCAGCCCTTGCCTCAGCATCTGAGCCAATCTAGCATTGCCAGCTCAATGTCCCATAGCACCACTGCCTCTGATCAAAGGCTCTTGGCCAGCATTACACCCTCACCTTCAGGCCAATCCATCATCCGAACCCAACCTGGAGCAGGGGTCCACCCAAAGGCTGATGGTGCTCTGAAGGGAGAAGCTGAGCAATCTGCAGGGCACCCTAGTGAGCACCTCTTCATCTGTGAGGAATGTGGGCGCTGCAAGTGCGTCCCCTGCACAGCAGCTCGCCCTCTCCCCTCCTGCTGGCTGTGCAACCAGCGCTGCCTTTGCTCTGCTGAGAGCCTCCTCGATTATGGCACTTGTCTCTGCTGTGTCAAGGGCCTCTTCTACCACTGCTCCACTGATGATGAAGACAACTGTGCTGATGAGCCCTGCTCTTGTGGGCCTAGTTCTTGCTTTGTCCGCTGGGCAGCCATGAGCCTCATCTCCCTCTTCCTACCCTGCCTGTGCTGCTACCTGCCTACCCGTGGATGCCTCCATCTGTGCCAACAGGGCTATGATAGCCTCCGGCGACCAGGCTGCCGCTGCAAGAGGCACACCAACACTGTGTGCAGAAAGATCTCTTCTGGTAGTGCACCCTTCCCCAAGGCCCAGGAAAAGTCTGTATGA
ORF Protein Sequence MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAGVHPKADGALKGEAEQSAGHPSEHLFICEECGRCKCVPCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPSSCFVRWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1814-Ab Anti-SPRY3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1814-Ag SPRY3 protein
    Cytokine cks-Tg-g-GM-IP1814 sprouty homolog 3 (Drosophila) (SPRY3) protein & antibody
    ORF Viral Vector pGMLP005605 Human SPRY3 Lentivirus plasmid
    ORF Viral Vector vGMLP005605 Human SPRY3 Lentivirus particle


    Target information

    Target ID GM-IP1814
    Target Name SPRY3
    Gene ID 10251, 236576, 703923, 498159, 101094659, 492271, 539402, 100062480
    Gene Symbol and Synonyms Gm1409,Gm391,RGD1562172,sprouty3,spry-3,SPRY3
    Uniprot Accession O43610
    Uniprot Entry Name SPY3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000168939
    Target Classification Not Available

    Involved in negative regulation of MAPK cascade. Predicted to be located in membrane. Predicted to be active in cytosol. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.