Human SPRY3/spry-3 ORF/cDNA clone-Lentivirus plasmid (NM_001304990.1)
Cat. No.: pGMLP005605
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SPRY3/spry-3 Lentiviral expression plasmid for SPRY3 lentivirus packaging, SPRY3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
SPRY3/spry-3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP005605 |
Gene Name | SPRY3 |
Accession Number | NM_001304990.1 |
Gene ID | 10251 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 867 bp |
Gene Alias | spry-3 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGATGCTGCGGTGACAGATGATTTTCAACAAATTCTGCCTATTGAACAGCTGCGCTCTACTCATGCTAGCAATGACTACGTGGAACGGCCTCCAGCCCCCTGTAAACAGGCCCTCTCCAGCCCTTCCCTTATTGTGCAAACCCACAAGTCTGATTGGTCTCTGGCTACCATGCCTACTTCTCTCCCCCGCAGTCTCAGCCAGTGCCATCAACTGCAGCCCTTGCCTCAGCATCTGAGCCAATCTAGCATTGCCAGCTCAATGTCCCATAGCACCACTGCCTCTGATCAAAGGCTCTTGGCCAGCATTACACCCTCACCTTCAGGCCAATCCATCATCCGAACCCAACCTGGAGCAGGGGTCCACCCAAAGGCTGATGGTGCTCTGAAGGGAGAAGCTGAGCAATCTGCAGGGCACCCTAGTGAGCACCTCTTCATCTGTGAGGAATGTGGGCGCTGCAAGTGCGTCCCCTGCACAGCAGCTCGCCCTCTCCCCTCCTGCTGGCTGTGCAACCAGCGCTGCCTTTGCTCTGCTGAGAGCCTCCTCGATTATGGCACTTGTCTCTGCTGTGTCAAGGGCCTCTTCTACCACTGCTCCACTGATGATGAAGACAACTGTGCTGATGAGCCCTGCTCTTGTGGGCCTAGTTCTTGCTTTGTCCGCTGGGCAGCCATGAGCCTCATCTCCCTCTTCCTACCCTGCCTGTGCTGCTACCTGCCTACCCGTGGATGCCTCCATCTGTGCCAACAGGGCTATGATAGCCTCCGGCGACCAGGCTGCCGCTGCAAGAGGCACACCAACACTGTGTGCAGAAAGATCTCTTCTGGTAGTGCACCCTTCCCCAAGGCCCAGGAAAAGTCTGTATGA |
ORF Protein Sequence | MDAAVTDDFQQILPIEQLRSTHASNDYVERPPAPCKQALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCHQLQPLPQHLSQSSIASSMSHSTTASDQRLLASITPSPSGQSIIRTQPGAGVHPKADGALKGEAEQSAGHPSEHLFICEECGRCKCVPCTAARPLPSCWLCNQRCLCSAESLLDYGTCLCCVKGLFYHCSTDDEDNCADEPCSCGPSSCFVRWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1814-Ab | Anti-SPRY3 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1814-Ag | SPRY3 protein |
Cytokine | cks-Tg-g-GM-IP1814 | sprouty homolog 3 (Drosophila) (SPRY3) protein & antibody |
ORF Viral Vector | pGMLP005605 | Human SPRY3 Lentivirus plasmid |
ORF Viral Vector | vGMLP005605 | Human SPRY3 Lentivirus particle |
Target information
Target ID | GM-IP1814 |
Target Name | SPRY3 |
Gene ID | 10251, 236576, 703923, 498159, 101094659, 492271, 539402, 100062480 |
Gene Symbol and Synonyms | Gm1409,Gm391,RGD1562172,sprouty3,spry-3,SPRY3 |
Uniprot Accession | O43610 |
Uniprot Entry Name | SPY3_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Cytokine Target |
Disease | Not Available |
Gene Ensembl | ENSG00000168939 |
Target Classification | Not Available |
Involved in negative regulation of MAPK cascade. Predicted to be located in membrane. Predicted to be active in cytosol. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.