Human LGALS3/CBP35/GAL3 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002306.4)

Cat. No.: pGMPC000875
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LGALS3/CBP35/GAL3 Non-Viral expression plasmid (overexpression vector) for mouse LGALS3 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to LGALS3/CBP35 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000875
Gene Name LGALS3
Accession Number NM_002306.4
Gene ID 3958
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 753 bp
Gene Alias CBP35,GAL3,GALBP,GALIG,L31,LGALS2,MAC2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGACAATTTTTCGCTCCATGATGCGTTATCTGGGTCTGGAAACCCAAACCCTCAAGGATGGCCTGGCGCATGGGGGAACCAGCCTGCTGGGGCAGGGGGCTACCCAGGGGCTTCCTATCCTGGGGCCTACCCCGGGCAGGCACCCCCAGGGGCTTATCCTGGACAGGCACCTCCAGGCGCCTACCCTGGAGCACCTGGAGCTTATCCCGGAGCACCTGCACCTGGAGTCTACCCAGGGCCACCCAGCGGCCCTGGGGCCTACCCATCTTCTGGACAGCCAAGTGCCACCGGAGCCTACCCTGCCACTGGCCCCTATGGCGCCCCTGCTGGGCCACTGATTGTGCCTTATAACCTGCCTTTGCCTGGGGGAGTGGTGCCTCGCATGCTGATAACAATTCTGGGCACGGTGAAGCCCAATGCAAACAGAATTGCTTTAGATTTCCAAAGAGGGAATGATGTTGCCTTCCACTTTAACCCACGCTTCAATGAGAACAACAGGAGAGTCATTGTTTGCAATACAAAGCTGGATAATAACTGGGGAAGGGAAGAAAGACAGTCGGTTTTCCCATTTGAAAGTGGGAAACCATTCAAAATACAAGTACTGGTTGAACCTGACCACTTCAAGGTTGCAGTGAATGATGCTCACTTGTTGCAGTACAATCATCGGGTTAAAAAACTCAATGAAATCAGCAAACTGGGAATTTCTGGTGACATAGACCTCACCAGTGCTTCATATACCATGATATAA
ORF Protein Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T72038-Ab Anti-LEG3/ LGALS3/ CBP35 monoclonal antibody
    Target Antigen GM-Tg-g-T72038-Ag LGALS3 VLP (virus-like particle)
    ORF Viral Vector pGMLP000501 Human LGALS3 Lentivirus plasmid
    ORF Viral Vector pGMLV001314 Human LGALS3 Lentivirus plasmid
    ORF Viral Vector pGMLV002196 Human LGALS3 Lentivirus plasmid
    ORF Viral Vector pGMLV002276 Human LGALS3 Lentivirus plasmid
    ORF Viral Vector pGMAP000432 Human LGALS3 Adenovirus plasmid
    ORF Viral Vector pGMPC000875 Human LGALS3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001102 Human LGALS3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000501 Human LGALS3 Lentivirus particle
    ORF Viral Vector vGMLV001314 Human LGALS3 Lentivirus particle
    ORF Viral Vector vGMLV002196 Human LGALS3 Lentivirus particle
    ORF Viral Vector vGMLV002276 Human LGALS3 Lentivirus particle
    ORF Viral Vector vGMAP000432 Human LGALS3 Adenovirus particle


    Target information

    Target ID GM-T72038
    Target Name LGALS3
    Gene ID 3958, 16854, 697290, 83781, 101081472, 404021, 786492, 100050367
    Gene Symbol and Synonyms AGE-R3,CBP 35,CBP30,CBP35,gal-3,GAL3,GALBP,Galectin-3,GALIG,GBP,L-34,L31,LGALS2,LGALS3,Mac-2,MAC2
    Uniprot Accession P17931
    Uniprot Entry Name LEG3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Cancer
    Gene Ensembl ENSG00000131981
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)

    This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.