Human LGALS3/CBP35/GAL3 ORF/cDNA clone-Lentivirus particle (NM_002306.4)
Cat. No.: vGMLV002196
Pre-made Human LGALS3/CBP35/GAL3 Lentiviral expression plasmid for LGALS3 lentivirus packaging, LGALS3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
LGALS3/CBP35 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV002196 | Human LGALS3 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV002196 |
Gene Name | LGALS3 |
Accession Number | NM_002306.4 |
Gene ID | 3958 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 753 bp |
Gene Alias | CBP35,GAL3,GALBP,GALIG,L31,LGALS2,MAC2 |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | Null |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCAGACAATTTTTCGCTCCATGATGCGTTATCTGGGTCTGGAAACCCAAACCCTCAAGGATGGCCTGGCGCATGGGGGAACCAGCCTGCTGGGGCAGGGGGCTACCCAGGGGCTTCCTATCCTGGGGCCTACCCCGGGCAGGCACCCCCAGGGGCTTATCCTGGACAGGCACCTCCAGGCGCCTACCCTGGAGCACCTGGAGCTTATCCCGGAGCACCTGCACCTGGAGTCTACCCAGGGCCACCCAGCGGCCCTGGGGCCTACCCATCTTCTGGACAGCCAAGTGCCACCGGAGCCTACCCTGCCACTGGCCCCTATGGCGCCCCTGCTGGGCCACTGATTGTGCCTTATAACCTGCCTTTGCCTGGGGGAGTGGTGCCTCGCATGCTGATAACAATTCTGGGCACGGTGAAGCCCAATGCAAACAGAATTGCTTTAGATTTCCAAAGAGGGAATGATGTTGCCTTCCACTTTAACCCACGCTTCAATGAGAACAACAGGAGAGTCATTGTTTGCAATACAAAGCTGGATAATAACTGGGGAAGGGAAGAAAGACAGTCGGTTTTCCCATTTGAAAGTGGGAAACCATTCAAAATACAAGTACTGGTTGAACCTGACCACTTCAAGGTTGCAGTGAATGATGCTCACTTGTTGCAGTACAATCATCGGGTTAAAAAACTCAATGAAATCAGCAAACTGGGAATTTCTGGTGACATAGACCTCACCAGTGCTTCATATACCATGATATAA |
ORF Protein Sequence | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T72038-Ab | Anti-LEG3/ LGALS3/ CBP35 monoclonal antibody |
Target Antigen | GM-Tg-g-T72038-Ag | LGALS3 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000501 | Human LGALS3 Lentivirus plasmid |
ORF Viral Vector | pGMLV001314 | Human LGALS3 Lentivirus plasmid |
ORF Viral Vector | pGMLV002196 | Human LGALS3 Lentivirus plasmid |
ORF Viral Vector | pGMLV002276 | Human LGALS3 Lentivirus plasmid |
ORF Viral Vector | pGMAP000432 | Human LGALS3 Adenovirus plasmid |
ORF Viral Vector | pGMPC000875 | Human LGALS3 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001102 | Human LGALS3 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000501 | Human LGALS3 Lentivirus particle |
ORF Viral Vector | vGMLV001314 | Human LGALS3 Lentivirus particle |
ORF Viral Vector | vGMLV002196 | Human LGALS3 Lentivirus particle |
ORF Viral Vector | vGMLV002276 | Human LGALS3 Lentivirus particle |
ORF Viral Vector | vGMAP000432 | Human LGALS3 Adenovirus particle |
Target information
Target ID | GM-T72038 |
Target Name | LGALS3 |
Gene ID | 3958, 16854, 697290, 83781, 101081472, 404021, 786492, 100050367 |
Gene Symbol and Synonyms | AGE-R3,CBP 35,CBP30,CBP35,gal-3,GAL3,GALBP,Galectin-3,GALIG,GBP,L-34,L31,LGALS2,LGALS3,Mac-2,MAC2 |
Uniprot Accession | P17931 |
Uniprot Entry Name | LEG3_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, Immuno-oncology Target |
Disease | Cancer |
Gene Ensembl | ENSG00000131981 |
Target Classification | Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA) |
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.