Human RAB3B ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002867)

Cat. No.: pGMPC000927
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAB3B/ Non-Viral expression plasmid (overexpression vector) for mouse RAB3B overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RAB3B/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000927
Gene Name RAB3B
Accession Number NM_002867
Gene ID 5865
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 660 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCAGTGACAGATGGTAAAACTGGAGTCAAAGATGCCTCTGACCAGAATTTTGACTACATGTTTAAACTGCTTATCATTGGCAACAGCAGTGTTGGCAAGACCTCCTTCCTCTTCCGCTATGCTGATGACACGTTCACCCCAGCCTTCGTTAGCACCGTGGGCATCGACTTCAAGGTGAAGACAGTCTACCGTCACGAGAAGCGGGTGAAACTGCAGATCTGGGACACAGCTGGGCAGGAGCGGTACCGGACCATCACAACAGCCTATTACCGTGGGGCCATGGGCTTCATTCTGATGTATGACATCACCAATGAAGAGTCCTTCAATGCTGTCCAAGACTGGGCTACTCAGATCAAGACCTACTCCTGGGACAATGCACAAGTTATTCTGGTGGGGAACAAGTGTGACATGGAGGAAGAGAGGGTTGTTCCCACTGAGAAGGGCCAGCTCCTTGCAGAGCAGCTTGGGTTTGATTTCTTTGAAGCCAGTGCAAAGGAGAACATCAGTGTAAGGCAGGCCTTTGAGCGCCTGGTGGATGCCATTTGTGACAAGATGTCTGATTCGCTGGACACAGACCCGTCGATGCTGGGCTCCTCCAAGAACACGCGTCTCTCGGACACCCCACCGCTGCTGCAGCAGAACTGCTCATGCTAG
ORF Protein Sequence MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2276-Ab Anti-RAB3B monoclonal antibody
    Target Antigen GM-Tg-g-MP2276-Ag RAB3B VLP (virus-like particle)
    ORF Viral Vector pGMLP000069 Human RAB3B Lentivirus plasmid
    ORF Viral Vector pGMPC000927 Human RAB3B Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000069 Human RAB3B Lentivirus particle


    Target information

    Target ID GM-MP2276
    Target Name RAB3B
    Gene ID 5865, 69908, 712683, 81755, 101089377, 608161, 282030, 100062293
    Gene Symbol and Synonyms 2610528C18Rik,RAB3B
    Uniprot Accession P20337
    Uniprot Entry Name RAB3B_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Prostate Cancer, Malignant neoplasm of prostate
    Gene Ensembl ENSG00000169213
    Target Classification Not Available

    Enables GDP binding activity; GTPase activity; and myosin V binding activity. Involved in several processes, including positive regulation of dopamine uptake involved in synaptic transmission; regulation of synaptic vesicle cycle; and regulation of vesicle size. Located in perinuclear region of cytoplasm and vesicle. Is active in dopaminergic synapse. Is anchored component of synaptic vesicle membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.