Human RAB3B ORF/cDNA clone-Lentivirus particle (NM_002867)
Cat. No.: vGMLP000069
Pre-made Human RAB3B/ Lentiviral expression plasmid for RAB3B lentivirus packaging, RAB3B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
RAB3B/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000069 | Human RAB3B Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000069 |
| Gene Name | RAB3B |
| Accession Number | NM_002867 |
| Gene ID | 5865 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 660 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTTCAGTGACAGATGGTAAAACTGGAGTCAAAGATGCCTCTGACCAGAATTTTGACTACATGTTTAAACTGCTTATCATTGGCAACAGCAGTGTTGGCAAGACCTCCTTCCTCTTCCGCTATGCTGATGACACGTTCACCCCAGCCTTCGTTAGCACCGTGGGCATCGACTTCAAGGTGAAGACAGTCTACCGTCACGAGAAGCGGGTGAAACTGCAGATCTGGGACACAGCTGGGCAGGAGCGGTACCGGACCATCACAACAGCCTATTACCGTGGGGCCATGGGCTTCATTCTGATGTATGACATCACCAATGAAGAGTCCTTCAATGCTGTCCAAGACTGGGCTACTCAGATCAAGACCTACTCCTGGGACAATGCACAAGTTATTCTGGTGGGGAACAAGTGTGACATGGAGGAAGAGAGGGTTGTTCCCACTGAGAAGGGCCAGCTCCTTGCAGAGCAGCTTGGGTTTGATTTCTTTGAAGCCAGTGCAAAGGAGAACATCAGTGTAAGGCAGGCCTTTGAGCGCCTGGTGGATGCCATTTGTGACAAGATGTCTGATTCGCTGGACACAGACCCGTCGATGCTGGGCTCCTCCAAGAACACGCGTCTCTCGGACACCCCACCGCTGCTGCAGCAGAACTGCTCATGCTAG |
| ORF Protein Sequence | MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP2276-Ab | Anti-RAB3B monoclonal antibody |
| Target Antigen | GM-Tg-g-MP2276-Ag | RAB3B VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000069 | Human RAB3B Lentivirus plasmid |
| ORF Viral Vector | pGMPC000927 | Human RAB3B Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000069 | Human RAB3B Lentivirus particle |
Target information
| Target ID | GM-MP2276 |
| Target Name | RAB3B |
| Gene ID | 5865, 69908, 712683, 81755, 101089377, 608161, 282030, 100062293 |
| Gene Symbol and Synonyms | 2610528C18Rik,RAB3B |
| Uniprot Accession | P20337 |
| Uniprot Entry Name | RAB3B_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Prostate Cancer, Malignant neoplasm of prostate |
| Gene Ensembl | ENSG00000169213 |
| Target Classification | Not Available |
Enables GDP binding activity; GTPase activity; and myosin V binding activity. Involved in several processes, including positive regulation of dopamine uptake involved in synaptic transmission; regulation of synaptic vesicle cycle; and regulation of vesicle size. Located in perinuclear region of cytoplasm and vesicle. Is active in dopaminergic synapse. Is anchored component of synaptic vesicle membrane. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


