Human EDA2R/EDA-A2R/EDAA2R ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_021783.5)

Cat. No.: pGMPC000971
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EDA2R/EDA-A2R/EDAA2R Non-Viral expression plasmid (overexpression vector) for mouse EDA2R overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to EDA2R/EDA-A2R products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000971
Gene Name EDA2R
Accession Number NM_021783.5
Gene ID 60401
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 894 bp
Gene Alias EDA-A2R,EDAA2R,TNFRSF27,XEDAR
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGATTGCCAAGAAAATGAGTACTGGGACCAATGGGGACGGTGTGTCACCTGCCAACGGTGTGGTCCTGGACAGGAGCTATCCAAGGATTGTGGTTATGGAGAGGGTGGAGATGCCTACTGCACAGCCTGCCCTCCTCGCAGGTACAAAAGCAGCTGGGGCCACCACAGATGTCAGAGTTGCATCACCTGTGCTGTCATCAATCGTGTTCAGAAGGTCAACTGCACAGCTACCTCTAATGCTGTCTGTGGGGACTGTTTGCCCAGGTTCTACCGAAAGACACGCATTGGAGGCCTGCAGGACCAAGAGTGCATCCCGTGCACGAAGCAGACCCCCACCTCTGAGGTTCAATGTGCCTTCCAGTTGAGCTTAGTGGAGGCAGATACACCCACAGTGCCCCCTCAGGAGGCCACACTTGTTGCACTGGTGAGCAGCCTGCTAGTGGTGTTTACCCTGGCCTTCCTGGGGCTCTTCTTCCTCTACTGCAAGCAGTTCTTCAACAGACATTGCCAGCGTGGAGGTTTGCTGCAGTTTGAGGCTGATAAAACAGCAAAGGAGGAATCTCTCTTCCCCGTGCCACCCAGCAAGGAGACCAGTGCTGAGTCCCAAGTGAGTGAGAACATCTTTCAGACCCAGCCACTTAACCCTATCCTCGAGGACGACTGCAGCTCGACTAGTGGCTTCCCCACACAGGAGTCCTTTACCATGGCCTCCTGCACCTCAGAGAGCCACTCCCACTGGGTCCACAGCCCCATCGAATGCACAGAGCTGGACCTGCAAAAGTTTTCCAGCTCTGCCTCCTATACTGGAGCTGAGACCTTGGGGGGAAACACAGTCGAAAGCACTGGAGACAGGCTGGAGCTCAATGTGCCCTTTGAAGTTCCCAGCCCTTAA
ORF Protein Sequence MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADTPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0390-Ab Anti-TNR27/ EDA2R/ EDA-A2R monoclonal antibody
    Target Antigen GM-Tg-g-MP0390-Ag EDA2R VLP (virus-like particle)
    ORF Viral Vector pGMPC000971 Human EDA2R Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-MP0390
    Target Name EDA2R
    Gene ID 60401, 245527, 710244, 296872, 101084857, 100301324, 100065857
    Gene Symbol and Synonyms 9430060M22Rik,EDA-A2R,EDA2R,EDAA2R,RGD1564025,TNFRSF27,XEDAR
    Uniprot Accession Q9HAV5
    Uniprot Entry Name TNR27_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000131080
    Target Classification Not Available

    The protein encoded by this gene is a type III transmembrane protein of the TNFR (tumor necrosis factor receptor) superfamily, and contains cysteine-rich repeats and a single transmembrane domain. This protein binds to the EDA-A2 isoform of ectodysplasin, which plays an important role in maintenance of hair and teeth. Alternatively spliced transcript variants encodes distinct protein isoforms. [provided by RefSeq, Apr 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.