Human SUMO1/DAP1/GMP1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_003352.8)

Cat. No.: pGMPC001223
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SUMO1/DAP1/GMP1 Non-Viral expression plasmid (overexpression vector) for mouse SUMO1 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to SUMO1/DAP1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001223
Gene Name SUMO1
Accession Number NM_003352.8
Gene ID 7341
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 306 bp
Gene Alias DAP1,GMP1,OFC10,PIC1,SENP2,SMT3,SMT3C,SMT3H3,UBL1
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag HA (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGACCAGGAGGCAAAACCTTCAACTGAGGACTTGGGGGATAAGAAGGAAGGTGAATATATTAAACTCAAAGTCATTGGACAGGATAGCAGTGAGATTCACTTCAAAGTGAAAATGACAACACATCTCAAGAAACTCAAAGAATCATACTGTCAAAGACAGGGTGTTCCAATGAATTCACTCAGGTTTCTCTTTGAGGGTCAGAGAATTGCTGATAATCATACTCCAAAAGAACTGGGAATGGAGGAAGAAGATGTGATTGAAGTTTATCAGGAACAAACGGGGGGTCATTCAACAGTTTAG
ORF Protein Sequence MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA023-Ab Anti-SUMO1 monoclonal antibody
    Target Antigen GM-Tg-g-TA023-Ag SUMO1 protein
    ORF Viral Vector pGMLP000463 Human SUMO1 Lentivirus plasmid
    ORF Viral Vector pGMAP000313 Human SUMO1 Adenovirus plasmid
    ORF Viral Vector pGMPC000059 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001223 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001826 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001862 Human SUMO1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000463 Human SUMO1 Lentivirus particle
    ORF Viral Vector vGMAP000313 Human SUMO1 Adenovirus particle


    Target information

    Target ID GM-TA023
    Target Name SUMO1
    Gene ID 7341, 22218, 703644, 301442, 101095673, 478874, 614967, 100067107
    Gene Symbol and Synonyms DAP1,GMP1,OFC10,PIC1,SENP2,SENTRIN,SMT3,SMT3C,SMT3H3,SMTP3,SUMO-1,SUMO1,UBL1
    Uniprot Accession P63165
    Uniprot Entry Name SUMO1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000116030
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.