Human SUMO1/GMP1/PIC1 ORF/cDNA clone-Adenovirus particle (BC006462)
Cat. No.: vGMAP000313
Pre-made Human SUMO1/GMP1/PIC1 Adenovirus for SUMO1 overexpression in-vitro and in-vivo. The SUMO1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified SUMO1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
SUMO1/GMP1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000313 | Human SUMO1 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000313 |
| Gene Name | SUMO1 |
| Accession Number | BC006462 |
| Gene ID | 7341 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 306 bp |
| Gene Alias | GMP1,PIC1,SENP2,SMT3,SMT3C,SMT3H3,SUMO-1 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCTGACCAGGAGGCAAAACCTTCAACTGAGGACTTGGGGGATAAGAAGGAAGGTGAATATATTAAACTCAAAGTCATTGGACAGGATAGCAGTGAGATTCACTTCAAAGTGAAAATGACAACACATCTCAAGAAACTCAAAGAATCATACTGTCAAAGACAGGGTGTTCCAATGAATTCACTCAGGTTTCTCTTTGAGGGTCAGAGAATTGCTGATAATCATACTCCAAAAGAACTGGGAATGGAGGAAGAAGATGTGATTGAAGTTTATCAGGAACAAACGGGGGGTCATTCAACAGTTTAG |
| ORF Protein Sequence | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-TA023-Ab | Anti-SUMO1 monoclonal antibody |
| Target Antigen | GM-Tg-g-TA023-Ag | SUMO1 protein |
| ORF Viral Vector | pGMLP000463 | Human SUMO1 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000313 | Human SUMO1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000059 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001223 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001826 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001862 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000463 | Human SUMO1 Lentivirus particle |
| ORF Viral Vector | vGMAP000313 | Human SUMO1 Adenovirus particle |
Target information
| Target ID | GM-TA023 |
| Target Name | SUMO1 |
| Gene ID | 7341, 22218, 703644, 301442, 101095673, 478874, 614967, 100067107 |
| Gene Symbol and Synonyms | DAP1,GMP1,OFC10,PIC1,SENP2,SENTRIN,SMT3,SMT3C,SMT3H3,SMTP3,SUMO-1,SUMO1,UBL1 |
| Uniprot Accession | P63165 |
| Uniprot Entry Name | SUMO1_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | Cancer |
| Gene Ensembl | ENSG00000116030 |
| Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


