Human SUMO1/DAP1/GMP1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_003352)
Cat. No.: pGMPC001862
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SUMO1/DAP1/GMP1 Non-Viral expression plasmid (overexpression vector) for mouse SUMO1 overexpression in unique cell transient transfection and stable cell line development.
Go to
SUMO1/DAP1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC001862 |
Gene Name | SUMO1 |
Accession Number | NM_003352 |
Gene ID | 7341 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 306 bp |
Gene Alias | DAP1,GMP1,OFC10,PIC1,SENP2,SMT3,SMT3C,SMT3H3,UBL1 |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Null |
Fusion Tag | MYC (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCTGACCAGGAGGCAAAACCTTCAACTGAGGACTTGGGGGATAAGAAGGAAGGTGAATATATTAAACTCAAAGTCATTGGACAGGATAGCAGTGAGATTCACTTCAAAGTGAAAATGACAACACATCTCAAGAAACTCAAAGAATCATACTGTCAAAGACAGGGTGTTCCAATGAATTCACTCAGGTTTCTCTTTGAGGGTCAGAGAATTGCTGATAATCATACTCCAAAAGAACTGGGAATGGAGGAAGAAGATGTGATTGAAGTTTATCAGGAACAAACGGGGGGTCATTCAACAGTTTAG |
ORF Protein Sequence | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-TA023-Ab | Anti-SUMO1 monoclonal antibody |
Target Antigen | GM-Tg-g-TA023-Ag | SUMO1 protein |
ORF Viral Vector | pGMLP000463 | Human SUMO1 Lentivirus plasmid |
ORF Viral Vector | pGMAP000313 | Human SUMO1 Adenovirus plasmid |
ORF Viral Vector | pGMPC000059 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001223 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001826 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001862 | Human SUMO1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000463 | Human SUMO1 Lentivirus particle |
ORF Viral Vector | vGMAP000313 | Human SUMO1 Adenovirus particle |
Target information
Target ID | GM-TA023 |
Target Name | SUMO1 |
Gene ID | 7341, 22218, 703644, 301442, 101095673, 478874, 614967, 100067107 |
Gene Symbol and Synonyms | DAP1,GMP1,OFC10,PIC1,SENP2,SENTRIN,SMT3,SMT3C,SMT3H3,SMTP3,SUMO-1,SUMO1,UBL1 |
Uniprot Accession | P63165 |
Uniprot Entry Name | SUMO1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000116030 |
Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.