Human S100A6/2A9/5B10 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_014624.4)

Cat. No.: pGMPC001633
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human S100A6/2A9/5B10 Non-Viral expression plasmid (overexpression vector) for mouse S100A6 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to S100A6/2A9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001633
Gene Name S100A6
Accession Number NM_014624.4
Gene ID 6277
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 273 bp
Gene Alias 2A9,5B10,CABP,CACY,PRA,S10A6
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCATGCCCCCTGGATCAGGCCATTGGCCTCCTCGTGGCCATCTTCCACAAGTACTCCGGCAGGGAGGGTGACAAGCACACCCTGAGCAAGAAGGAGCTGAAGGAGCTGATCCAGAAGGAGCTCACCATTGGCTCGAAGCTGCAGGATGCTGAAATTGCAAGGCTGATGGAAGACTTGGACCGGAACAAGGACCAGGAGGTGAACTTCCAGGAGTATGTCACCTTCCTGGGGGCCTTGGCTTTGATCTACAATGAAGCCCTCAAGGGCTGA
ORF Protein Sequence MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T68513-Ab Anti-S10A6/ S100A6/ 2A9 monoclonal antibody
    Target Antigen GM-Tg-g-T68513-Ag S100A6 VLP (virus-like particle)
    ORF Viral Vector pGMLP000396 Human S100A6 Lentivirus plasmid
    ORF Viral Vector pGMLV002374 Human S100A6 Lentivirus plasmid
    ORF Viral Vector pGMPC001633 Human S100A6 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000396 Human S100A6 Lentivirus particle
    ORF Viral Vector vGMLV002374 Human S100A6 Lentivirus particle


    Target information

    Target ID GM-T68513
    Target Name S100A6
    Gene ID 6277, 20200, 715169, 85247, 101083651, 480143, 100033887
    Gene Symbol and Synonyms 2A9,5B10,CABP,CACY,CALCYCLIN,PRA,S100A6,S10A6
    Uniprot Accession P06703
    Uniprot Entry Name S10A6_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Breast Cancer, Congenital occlusion of ureteropelvic junction, Gastrointestinal system cancer
    Gene Ensembl ENSG00000197956
    Target Classification Not Available

    The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.