Human S100A6/2A9/5B10 ORF/cDNA clone-Lentivirus particle (NM_014624)
Cat. No.: vGMLP000396
Pre-made Human S100A6/2A9/5B10 Lentiviral expression plasmid for S100A6 lentivirus packaging, S100A6 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
S100A6/2A9 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000396 | Human S100A6 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000396 |
| Gene Name | S100A6 |
| Accession Number | NM_014624 |
| Gene ID | 6277 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 273 bp |
| Gene Alias | 2A9,5B10,CABP,CACY,PRA,S10A6 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCATGCCCCCTGGATCAGGCCATTGGCCTCCTCGTGGCCATCTTCCACAAGTACTCCGGCAGGGAGGGTGACAAGCACACCCTGAGCAAGAAGGAGCTGAAGGAGCTGATCCAGAAGGAGCTCACCATTGGCTCGAAGCTGCAGGATGCTGAAATTGCAAGGCTGATGGAAGACTTGGACCGGAACAAGGACCAGGAGGTGAACTTCCAGGAGTATGTCACCTTCCTGGGGGCCTTGGCTTTGATCTACAATGAAGCCCTCAAGGGCTGA |
| ORF Protein Sequence | MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T68513-Ab | Anti-S10A6/ S100A6/ 2A9 monoclonal antibody |
| Target Antigen | GM-Tg-g-T68513-Ag | S100A6 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000396 | Human S100A6 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002374 | Human S100A6 Lentivirus plasmid |
| ORF Viral Vector | pGMPC001633 | Human S100A6 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000396 | Human S100A6 Lentivirus particle |
| ORF Viral Vector | vGMLV002374 | Human S100A6 Lentivirus particle |
Target information
| Target ID | GM-T68513 |
| Target Name | S100A6 |
| Gene ID | 6277, 20200, 715169, 85247, 101083651, 480143, 100033887 |
| Gene Symbol and Synonyms | 2A9,5B10,CABP,CACY,CALCYCLIN,PRA,S100A6,S10A6 |
| Uniprot Accession | P06703 |
| Uniprot Entry Name | S10A6_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | Breast Cancer, Congenital occlusion of ureteropelvic junction, Gastrointestinal system cancer |
| Gene Ensembl | ENSG00000197956 |
| Target Classification | Not Available |
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


