Human YAP1/COB1/YAP ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001130145.3)

Cat. No.: pGMPC004884
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human YAP1/COB1/YAP Non-Viral expression plasmid (overexpression vector) for mouse YAP1 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to YAP1/COB1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC004884
Gene Name YAP1
Accession Number NM_001130145.3
Gene ID 10413
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 1515 bp
Gene Alias COB1,YAP,YAP-1,YAP2,YAP65,YKI
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag MYC (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATCCCGGGCAGCAGCCGCCGCCTCAACCGGCCCCCCAGGGCCAAGGGCAGCCGCCTTCGCAGCCCCCGCAGGGGCAGGGCCCGCCGTCCGGACCCGGGCAACCGGCACCCGCGGCGACCCAGGCGGCGCCGCAGGCACCCCCCGCCGGGCATCAGATCGTGCACGTCCGCGGGGACTCGGAGACCGACCTGGAGGCGCTCTTCAACGCCGTCATGAACCCCAAGACGGCCAACGTGCCCCAGACCGTGCCCATGAGGCTCCGGAAGCTGCCCGACTCCTTCTTCAAGCCGCCGGAGCCCAAATCCCACTCCCGACAGGCCAGTACTGATGCAGGCACTGCAGGAGCCCTGACTCCACAGCATGTTCGAGCTCATTCCTCTCCAGCTTCTCTGCAGTTGGGAGCTGTTTCTCCTGGGACACTGACCCCCACTGGAGTAGTCTCTGGCCCAGCAGCTACACCCACAGCTCAGCATCTTCGACAGTCTTCTTTTGAGATACCTGATGATGTACCTCTGCCAGCAGGTTGGGAGATGGCAAAGACATCTTCTGGTCAGAGATACTTCTTAAATCACATCGATCAGACAACAACATGGCAGGACCCCAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCAGAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCAGGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAGGCTTGACCCTCGTTTTGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAAACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTCCAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCTGAAACAGCAAGAACTGCTTCGGCAGGCAATGCGGAATATCAATCCCAGCACAGCAAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGAGCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAACAATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAG
ORF Protein Sequence MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T94048-Ab Anti-YAP1 monoclonal antibody
    Target Antigen GM-Tg-g-T94048-Ag YAP1 protein
    ORF Viral Vector pGMLP005732 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMLV000392 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMLV000567 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMLV000777 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMLV000998 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMLV001167 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMLV001168 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMLV001285 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMLV002267 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMLV002426 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMAD000063 Human YAP1 Adenovirus plasmid
    ORF Viral Vector pGMAD000620 Human YAP1 Adenovirus plasmid
    ORF Viral Vector pGMAAV000314 Human YAP1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV000884 Human YAP1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMLP-SPh-021 Human YAP1 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-161 Human YAP1 Adenovirus plasmid
    ORF Viral Vector pGMPC000428 Human YAP1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000964 Human YAP1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001203 Human YAP1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001272 Human YAP1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001403 Human YAP1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC004851 Human YAP1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC004884 Human YAP1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005732 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMLV000392 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMLV000567 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMLV000777 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMLV000998 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMLV001167 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMLV001168 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMLV001285 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMLV002267 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMLV002426 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMAD000063 Human YAP1 Adenovirus particle
    ORF Viral Vector vGMAD000620 Human YAP1 Adenovirus particle
    ORF Viral Vector vGMAAV000314 Human YAP1 Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV000884 Human YAP1 Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMLP-SPh-021 Human YAP1 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-161 Human YAP1 Adenovirus particle


    Target information

    Target ID GM-T94048
    Target Name YAP1
    Gene ID 10413, 22601, 704382, 363014, 101101408, 479465, 100336629, 100068834
    Gene Symbol and Synonyms COB1,YAP,YAP-1,YAP-65,YAP1,YAP2,YAP65,YKI,Yorkie
    Uniprot Accession P46937
    Uniprot Entry Name YAP1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000137693
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.