Human S100A12/CAAF1/CAGC ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_005621.2)
Cat. No.: vGMAAV000574
Pre-made Human S100A12/CAAF1/CAGC Adeno-associated virus particle for S100A12 in-vivo study, mechanism of action (MOA) research and S100A12-associated gene therapy development.
At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.
Go to
S100A12/CAAF1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | AAV serotype | AAV Grade | AAV quantity |
vGMAAV000574 | Human S100A12 Adeno-associate virus(AAV) particle | AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF | Pilot Grade | 1.0E+12VG/ml |
5.0E+12VG/ml | ||||
1E+13VG/ml | ||||
5E+13VG/ml | ||||
1E+14VG/ml | ||||
Research Grade | 1.0E+12VG/ml | |||
5.0E+12VG/ml | ||||
1E+13VG/ml | ||||
5E+13VG/ml | ||||
1E+14VG/ml | ||||
GMP-like Grade | inquiry | |||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAAV000574 |
Gene Name | S100A12 |
Accession Number | NM_005621.2 |
Gene ID | 6283 |
Species | Human |
Product Type | Adeno-associate virus(AAV) particle (overexpression) |
Insert Length | 279 bp |
Gene Alias | CAAF1,CAGC,CGRP,ENRAGE,MRP-6,MRP6,p6 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACAAAACTTGAAGAGCATCTGGAGGGAATTGTCAATATCTTCCACCAATACTCAGTTCGGAAGGGGCATTTTGACACCCTCTCTAAGGGTGAGCTGAAGCAGCTGCTTACAAAGGAGCTTGCAAACACCATCAAGAATATCAAAGATAAAGCTGTCATTGATGAAATATTCCAAGGCCTGGATGCTAATCAAGATGAACAGGTCGACTTTCAAGAATTCATATCCCTGGTAGCCATTGCGCTGAAGGCTGCCCATTACCACACCCACAAAGAGTAG |
ORF Protein Sequence | MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T07247-Ab | Anti-S10AC/ S100A12/ CAAF1 monoclonal antibody |
Target Antigen | GM-Tg-g-T07247-Ag | S100A12 VLP (virus-like particle) |
ORF Viral Vector | pGMLP004517 | Human S100A12 Lentivirus plasmid |
ORF Viral Vector | pGMAAV000574 | Human S100A12 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | pGMAAV001811 | Human S100A12 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | vGMLP004517 | Human S100A12 Lentivirus particle |
ORF Viral Vector | vGMAAV000574 | Human S100A12 Adeno-associate virus(AAV) particle |
ORF Viral Vector | vGMAAV001811 | Human S100A12 Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-T07247 |
Target Name | S100A12 |
Gene ID | 6283, 714792, 100683919, 100056061 |
Gene Symbol and Synonyms | CAAF1,CAGC,CGRP,ENRAGE,MRP-6,MRP6,p6,S100A12 |
Uniprot Accession | P80511 |
Uniprot Entry Name | S10AC_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Gastrointestinal system cancer |
Gene Ensembl | ENSG00000163221 |
Target Classification | Not Available |
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity. [provided by RefSeq, Nov 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.