Human S100A12/CAAF1/CAGC ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_005621)

Cat. No.: vGMAAV001811

Pre-made Human S100A12/CAAF1/CAGC Adeno-associated virus particle for S100A12 in-vivo study, mechanism of action (MOA) research and S100A12-associated gene therapy development.

At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.

Target products collection

Go to S100A12/CAAF1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name AAV serotype AAV Grade AAV quantity
vGMAAV001811 Human S100A12 Adeno-associate virus(AAV) particle AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF Pilot Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
Research Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAAV001811
Gene Name S100A12
Accession Number NM_005621
Gene ID 6283
Species Human
Product Type Adeno-associate virus(AAV) particle (overexpression)
Insert Length 279 bp
Gene Alias CAAF1,CAGC,CGRP,ENRAGE,MRP-6,MRP6,p6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter F4/80
Resistance Amplicin
ORF Nucleotide Sequence ATGACAAAACTTGAAGAGCATCTGGAGGGAATTGTCAATATCTTCCACCAATACTCAGTTCGGAAGGGGCATTTTGACACCCTCTCTAAGGGTGAGCTGAAGCAGCTGCTTACAAAGGAGCTTGCAAACACCATCAAGAATATCAAAGATAAAGCTGTCATTGATGAAATATTCCAAGGCCTGGATGCTAATCAAGATGAACAGGTCGACTTTCAAGAATTCATATCCCTGGTAGCCATTGCGCTGAAGGCTGCCCATTACCACACCCACAAAGAGTAG
ORF Protein Sequence MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T07247-Ab Anti-S10AC/ S100A12/ CAAF1 monoclonal antibody
    Target Antigen GM-Tg-g-T07247-Ag S100A12 VLP (virus-like particle)
    ORF Viral Vector pGMLP004517 Human S100A12 Lentivirus plasmid
    ORF Viral Vector pGMAAV000574 Human S100A12 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV001811 Human S100A12 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP004517 Human S100A12 Lentivirus particle
    ORF Viral Vector vGMAAV000574 Human S100A12 Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV001811 Human S100A12 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T07247
    Target Name S100A12
    Gene ID 6283, 714792, 100683919, 100056061
    Gene Symbol and Synonyms CAAF1,CAGC,CGRP,ENRAGE,MRP-6,MRP6,p6,S100A12
    Uniprot Accession P80511
    Uniprot Entry Name S10AC_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Gastrointestinal system cancer
    Gene Ensembl ENSG00000163221
    Target Classification Not Available

    The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity. [provided by RefSeq, Nov 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.