Human PAWR/Par-4/PAR4 ORF/cDNA clone-Adenovirus particle (NM_002583.3)

Cat. No.: vGMAD000440

Pre-made Human PAWR/Par-4/PAR4 Adenovirus for PAWR overexpression in-vitro and in-vivo. The PAWR adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified PAWR-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to PAWR/Par-4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000440 Human PAWR Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000440
Gene Name PAWR
Accession Number NM_002583.3
Gene ID 5074
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 1023 bp
Gene Alias Par-4,PAR4
Fluorescent Reporter RFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGACCGGTGGCTACCGGACCAGCAGCGGCCTCGGCGGCAGCACCACAGACTTCCTGGAGGAGTGGAAGGCGAAACGCGAGAAGATGCGCGCCAAGCAGAACCCCCCGGGCCCGGCCCCCCCGGGAGGGGGCAGCAGCGACGCCGCTGGGAAGCCCCCCGCGGGGGCTCTGGGCACCCCGGCGGCCGCCGCTGCCAACGAGCTCAACAACAACCTCCCGGGCGGCGCGCCGGCCGCACCTGCCGTCCCCGGTCCCGGGGGCGTGAACTGCGCGGTCGGCTCCGCCATGCTGACGCGGGCGGCCCCCGGCCCGCGGCGGTCGGAGGACGAGCCCCCAGCCGCCTCTGCCTCGGCTGCACCGCCGCCCCAGCGTGACGAGGAGGAGCCGGACGGCGTCCCAGAGAAGGGCAAGAGCTCGGGCCCCAGTGCCAGGAAAGGCAAGGGGCAGATCGAGAAGAGGAAGCTGCGGGAGAAGCGGCGCTCCACCGGCGTGGTCAACATCCCTGCCGCAGAGTGCTTAGATGAGTACGAAGATGATGAAGCAGGGCAGAAAGAGCGGAAACGAGAAGATGCAATTACACAACAGAACACTATTCAGAATGAAGCTGTAAACTTACTAGATCCAGGCAGTTCCTATCTGCTACAGGAGCCACCTAGAACAGTTTCAGGCAGATATAAAAGCACAACCAGTGTCTCTGAAGAAGATGTCTCAAGTAGATATTCTCGAACAGATAGAAGTGGGTTCCCTAGATATAACAGGGATGCAAATGTTTCAGGTACTCTGGTTTCAAGTAGCACACTGGAAAAGAAAATTGAAGATCTTGAAAAGGAAGTAGTAAGAGAAAGACAAGAAAACCTAAGACTTGTGAGACTGATGCAAGATAAAGAGGAAATGATTGGAAAACTCAAAGAAGAAATTGATTTATTAAATAGAGACCTAGATGACATAGAAGATGAAAATGAACAGCTAAAGCAGGAAAATAAAACTCTTTTGAAAGTTGTGGGTCAGCTGACCAGGTAG
ORF Protein Sequence MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T00496-Ab Anti-PAWR/ PAR4/ Par-4 monoclonal antibody
    Target Antigen GM-Tg-g-T00496-Ag PAWR VLP (virus-like particle)
    ORF Viral Vector pGMAD000142 Human PAWR Adenovirus plasmid
    ORF Viral Vector pGMAD000440 Human PAWR Adenovirus plasmid
    ORF Viral Vector vGMAD000142 Human PAWR Adenovirus particle
    ORF Viral Vector vGMAD000440 Human PAWR Adenovirus particle


    Target information

    Target ID GM-T00496
    Target Name PAWR
    Gene ID 5074, 114774, 695617, 64513, 101090029, 611487, 532789, 100060291
    Gene Symbol and Synonyms 2310001G03Rik,Par-4,PAR4,PAWR
    Uniprot Accession Q96IZ0
    Uniprot Entry Name PAWR_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000177425
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases. [provided by RefSeq, Aug 2017]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.