Human PAWR/Par-4/PAR4 ORF/cDNA clone-Adenovirus particle (NM_002583.3)
Cat. No.: vGMAD000440
Pre-made Human PAWR/Par-4/PAR4 Adenovirus for PAWR overexpression in-vitro and in-vivo. The PAWR adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified PAWR-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
PAWR/Par-4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAD000440 | Human PAWR Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAD000440 |
Gene Name | PAWR |
Accession Number | NM_002583.3 |
Gene ID | 5074 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 1023 bp |
Gene Alias | Par-4,PAR4 |
Fluorescent Reporter | RFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCGACCGGTGGCTACCGGACCAGCAGCGGCCTCGGCGGCAGCACCACAGACTTCCTGGAGGAGTGGAAGGCGAAACGCGAGAAGATGCGCGCCAAGCAGAACCCCCCGGGCCCGGCCCCCCCGGGAGGGGGCAGCAGCGACGCCGCTGGGAAGCCCCCCGCGGGGGCTCTGGGCACCCCGGCGGCCGCCGCTGCCAACGAGCTCAACAACAACCTCCCGGGCGGCGCGCCGGCCGCACCTGCCGTCCCCGGTCCCGGGGGCGTGAACTGCGCGGTCGGCTCCGCCATGCTGACGCGGGCGGCCCCCGGCCCGCGGCGGTCGGAGGACGAGCCCCCAGCCGCCTCTGCCTCGGCTGCACCGCCGCCCCAGCGTGACGAGGAGGAGCCGGACGGCGTCCCAGAGAAGGGCAAGAGCTCGGGCCCCAGTGCCAGGAAAGGCAAGGGGCAGATCGAGAAGAGGAAGCTGCGGGAGAAGCGGCGCTCCACCGGCGTGGTCAACATCCCTGCCGCAGAGTGCTTAGATGAGTACGAAGATGATGAAGCAGGGCAGAAAGAGCGGAAACGAGAAGATGCAATTACACAACAGAACACTATTCAGAATGAAGCTGTAAACTTACTAGATCCAGGCAGTTCCTATCTGCTACAGGAGCCACCTAGAACAGTTTCAGGCAGATATAAAAGCACAACCAGTGTCTCTGAAGAAGATGTCTCAAGTAGATATTCTCGAACAGATAGAAGTGGGTTCCCTAGATATAACAGGGATGCAAATGTTTCAGGTACTCTGGTTTCAAGTAGCACACTGGAAAAGAAAATTGAAGATCTTGAAAAGGAAGTAGTAAGAGAAAGACAAGAAAACCTAAGACTTGTGAGACTGATGCAAGATAAAGAGGAAATGATTGGAAAACTCAAAGAAGAAATTGATTTATTAAATAGAGACCTAGATGACATAGAAGATGAAAATGAACAGCTAAAGCAGGAAAATAAAACTCTTTTGAAAGTTGTGGGTCAGCTGACCAGGTAG |
ORF Protein Sequence | MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T00496-Ab | Anti-PAWR/ PAR4/ Par-4 monoclonal antibody |
Target Antigen | GM-Tg-g-T00496-Ag | PAWR VLP (virus-like particle) |
ORF Viral Vector | pGMAD000142 | Human PAWR Adenovirus plasmid |
ORF Viral Vector | pGMAD000440 | Human PAWR Adenovirus plasmid |
ORF Viral Vector | vGMAD000142 | Human PAWR Adenovirus particle |
ORF Viral Vector | vGMAD000440 | Human PAWR Adenovirus particle |
Target information
Target ID | GM-T00496 |
Target Name | PAWR |
Gene ID | 5074, 114774, 695617, 64513, 101090029, 611487, 532789, 100060291 |
Gene Symbol and Synonyms | 2310001G03Rik,Par-4,PAR4,PAWR |
Uniprot Accession | Q96IZ0 |
Uniprot Entry Name | PAWR_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000177425 |
Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases. [provided by RefSeq, Aug 2017]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.