Human ADCYAP1/PACAP ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_001099733.1)
Cat. No.: pGMAAV000317
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human ADCYAP1/PACAP Adeno-associated virus expression plasmid (ITR-vector) for ADCYAP1 AAV packaging, ADCYAP1 AAV production.The purified Human ADCYAP1/PACAP AAV particle serves as an invaluable asset for in-depth in vivo ADCYAP1 studies, mechanism of action (MOA) research, and the evolution of ADCYAP1-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Go to
PACAP-38/ADCYAP1/PACAP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAAV000317 |
Gene Name | ADCYAP1 |
Accession Number | NM_001099733.1 |
Gene ID | 116 |
Species | Human |
Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
Insert Length | 531 bp |
Gene Alias | PACAP |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | hSyn |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACCATGTGTAGCGGAGCGAGGCTGGCCCTGCTGGTCTATGGGATAATCATGCACAGCAGCGTCTACAGCTCACCTGCCGCCGCCGGACTCCGGTTCCCCGGGATCAGGCCAGAGGAAGAGGCGTACGGCGAGGACGGAAACCCGCTGCCAGACTTCGATGGCTCGGAGCCGCCGGGCGCAGGGAGCCCCGCCTCCGCGCCGCGCGCCGCCGCCGCCTGGTACCGCCCGGCCGGGAGAAGAGATGTCGCCCACGGGATCCTTAACGAGGCCTACCGCAAAGTGCTGGACCAGCTGTCCGCCGGGAAGCACCTGCAGTCGCTCGTGGCCCGGGGCGTGGGTGGGAGCCTCGGCGGCGGCGCGGGGGACGACGCGGAGCCGCTCTCCAAGCGCCACTCGGACGGGATCTTCACGGACAGCTACAGCCGCTACCGGAAACAAATGGCTGTCAAGAAATACTTGGCGGCCGTCCTAGGGAAGAGGTATAAACAAAGGGTTAAAAACAAAGGACGCCGAATAGCTTATTTGTAG |
ORF Protein Sequence | MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T07045-Ab | Anti-PACA/ PACAP-38/ ADCYAP1 functional antibody |
Target Antigen | GM-Tg-g-T07045-Ag | PACAP-38/ADCYAP1 protein |
ORF Viral Vector | pGMLP004453 | Human Adcyap1 Lentivirus plasmid |
ORF Viral Vector | pGMAAV000317 | Human ADCYAP1 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | vGMLP004453 | Human Adcyap1 Lentivirus particle |
ORF Viral Vector | vGMAAV000317 | Human ADCYAP1 Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-T07045 |
Target Name | PACAP-38 |
Gene ID | 116, 11516, 100424113, 24166, 101090471, 607433, 615187, 100061356 |
Gene Symbol and Synonyms | ADCYAP1,PACAP |
Uniprot Accession | P18509 |
Uniprot Entry Name | PACA_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Cancer |
Gene Ensembl | ENSG00000141433 |
Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.