Human RHOA/RHO12/RHOH12 ORF/cDNA clone-Lentivirus plasmid (BC001360)

Cat. No.: pGMLP-SPh-067
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RHOA/RHO12/RHOH12 Lentiviral expression plasmid for RHOA lentivirus packaging, RHOA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to RHOA/RHO12 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $445.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP-SPh-067
Gene Name RHOA
Accession Number BC001360
Gene ID 387
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 582 bp
Gene Alias RHO12,RHOH12
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGACCAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGTAGAGTTGGCTTTGTGGGACACAGCTGGGCAGGAAGATTATGATCGCCTGAGGCCCCTCTCCTACCCAGATACCGATGTTATACTGATGTGTTTTTCCATCGACAGCCCTGATAGTTTAGAAAACATCCCAGAAAAGTGGACCCCAGAAGTCAAGCATTTCTGTCCCAACGTGCCCATCATCCTGGTTGGGAATAAGAAGGATCTTCGGAATGATGAGCACACAAGGCGGGAGCTAGCCAAGATGAAGCAGGAGCCGGTGAAACCTGAAGAAGGCAGAGATATGGCAAACAGGATTGGCGCTTTTGGGTACATGGAGTGTTCAGCAAAGACCAAAGATGGAGTGAGAGAGGTTTTTGAAATGGCTACGAGAGCTGCTCTGCAAGCTAGACGTGGGAAGAAAAAATCTGGGTGCCTTGTCTTGTGA
ORF Protein Sequence MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T96736-Ab Anti-RHOA/ ARH12/ ARHA monoclonal antibody
    Target Antigen GM-Tg-g-T96736-Ag RHOA VLP (virus-like particle)
    ORF Viral Vector pGMLP005662 Human RHOA Lentivirus plasmid
    ORF Viral Vector pGMLV000967 Human RHOA Lentivirus plasmid
    ORF Viral Vector pGMLV001080 Human RHOA Lentivirus plasmid
    ORF Viral Vector pGMLV001496 Human RHOA Lentivirus plasmid
    ORF Viral Vector pGMAP000445 Human RHOA Adenovirus plasmid
    ORF Viral Vector pGMAP000543 Human RHOA Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-067 Human RHOA Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-207 Human RHOA Adenovirus plasmid
    ORF Viral Vector pGMPC000595 Human RHOA Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001816 Human RHOA Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005662 Human RHOA Lentivirus particle
    ORF Viral Vector vGMLV000967 Human RHOA Lentivirus particle
    ORF Viral Vector vGMLV001080 Human RHOA Lentivirus particle
    ORF Viral Vector vGMLV001496 Human RHOA Lentivirus particle
    ORF Viral Vector vGMAP000445 Human RHOA Adenovirus particle
    ORF Viral Vector vGMAP000543 Human RHOA Adenovirus particle
    ORF Viral Vector vGMLP-SPh-067 Human RHOA Lentivirus particle
    ORF Viral Vector vGMAP-SPh-207 Human RHOA Adenovirus particle


    Target information

    Target ID GM-T96736
    Target Name RHOA
    Gene ID 387, 11848, 706455, 117273, 101084011, 403954, 338049, 100053343
    Gene Symbol and Synonyms ARH12,ARHA,Arha1,Arha2,EDFAOB,RHO1,RHO12,RHOA,RHOH12
    Uniprot Accession P61586
    Uniprot Entry Name RHOA_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Breast Cancer
    Gene Ensembl ENSG00000067560
    Target Classification Not Available

    This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.