Human RHOA/RHO12/RHOH12 ORF/cDNA clone-Adenovirus plasmid (BC001360)
Cat. No.: pGMAP000445
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RHOA/RHO12/RHOH12 adenoviral expression plasmid for RHOA adenovirus packaging, RHOA adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
RHOA/RHO12 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP000445 |
Gene Name | RHOA |
Accession Number | BC001360 |
Gene ID | 387 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 582 bp |
Gene Alias | RHO12,RHOH12 |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGACCAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGTAGAGTTGGCTTTGTGGGACACAGCTGGGCAGGAAGATTATGATCGCCTGAGGCCCCTCTCCTACCCAGATACCGATGTTATACTGATGTGTTTTTCCATCGACAGCCCTGATAGTTTAGAAAACATCCCAGAAAAGTGGACCCCAGAAGTCAAGCATTTCTGTCCCAACGTGCCCATCATCCTGGTTGGGAATAAGAAGGATCTTCGGAATGATGAGCACACAAGGCGGGAGCTAGCCAAGATGAAGCAGGAGCCGGTGAAACCTGAAGAAGGCAGAGATATGGCAAACAGGATTGGCGCTTTTGGGTACATGGAGTGTTCAGCAAAGACCAAAGATGGAGTGAGAGAGGTTTTTGAAATGGCTACGAGAGCTGCTCTGCAAGCTAGACGTGGGAAGAAAAAATCTGGGTGCCTTGTCTTGTGA |
ORF Protein Sequence | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T96736-Ab | Anti-RHOA/ ARH12/ ARHA monoclonal antibody |
Target Antigen | GM-Tg-g-T96736-Ag | RHOA VLP (virus-like particle) |
ORF Viral Vector | pGMLP005662 | Human RHOA Lentivirus plasmid |
ORF Viral Vector | pGMLV000967 | Human RHOA Lentivirus plasmid |
ORF Viral Vector | pGMLV001080 | Human RHOA Lentivirus plasmid |
ORF Viral Vector | pGMLV001496 | Human RHOA Lentivirus plasmid |
ORF Viral Vector | pGMAP000445 | Human RHOA Adenovirus plasmid |
ORF Viral Vector | pGMAP000543 | Human RHOA Adenovirus plasmid |
ORF Viral Vector | pGMLP-SPh-067 | Human RHOA Lentivirus plasmid |
ORF Viral Vector | pGMAP-SPh-207 | Human RHOA Adenovirus plasmid |
ORF Viral Vector | pGMPC000595 | Human RHOA Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001816 | Human RHOA Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP005662 | Human RHOA Lentivirus particle |
ORF Viral Vector | vGMLV000967 | Human RHOA Lentivirus particle |
ORF Viral Vector | vGMLV001080 | Human RHOA Lentivirus particle |
ORF Viral Vector | vGMLV001496 | Human RHOA Lentivirus particle |
ORF Viral Vector | vGMAP000445 | Human RHOA Adenovirus particle |
ORF Viral Vector | vGMAP000543 | Human RHOA Adenovirus particle |
ORF Viral Vector | vGMLP-SPh-067 | Human RHOA Lentivirus particle |
ORF Viral Vector | vGMAP-SPh-207 | Human RHOA Adenovirus particle |
Target information
Target ID | GM-T96736 |
Target Name | RHOA |
Gene ID | 387, 11848, 706455, 117273, 101084011, 403954, 338049, 100053343 |
Gene Symbol and Synonyms | ARH12,ARHA,Arha1,Arha2,EDFAOB,RHO1,RHO12,RHOA,RHOH12 |
Uniprot Accession | P61586 |
Uniprot Entry Name | RHOA_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Breast Cancer |
Gene Ensembl | ENSG00000067560 |
Target Classification | Not Available |
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.