Human RHOA/RHO12/RHOH12 ORF/cDNA clone-Lentivirus particle (BC001360)
Cat. No.: vGMLP-SPh-067
Pre-made Human RHOA/RHO12/RHOH12 Lentiviral expression plasmid for RHOA lentivirus packaging, RHOA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
RHOA/RHO12 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP-SPh-067 | Human RHOA Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP-SPh-067 |
| Gene Name | RHOA |
| Accession Number | BC001360 |
| Gene ID | 387 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 582 bp |
| Gene Alias | RHO12,RHOH12 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGACCAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGTAGAGTTGGCTTTGTGGGACACAGCTGGGCAGGAAGATTATGATCGCCTGAGGCCCCTCTCCTACCCAGATACCGATGTTATACTGATGTGTTTTTCCATCGACAGCCCTGATAGTTTAGAAAACATCCCAGAAAAGTGGACCCCAGAAGTCAAGCATTTCTGTCCCAACGTGCCCATCATCCTGGTTGGGAATAAGAAGGATCTTCGGAATGATGAGCACACAAGGCGGGAGCTAGCCAAGATGAAGCAGGAGCCGGTGAAACCTGAAGAAGGCAGAGATATGGCAAACAGGATTGGCGCTTTTGGGTACATGGAGTGTTCAGCAAAGACCAAAGATGGAGTGAGAGAGGTTTTTGAAATGGCTACGAGAGCTGCTCTGCAAGCTAGACGTGGGAAGAAAAAATCTGGGTGCCTTGTCTTGTGA |
| ORF Protein Sequence | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T96736-Ab | Anti-RHOA/ ARH12/ ARHA monoclonal antibody |
| Target Antigen | GM-Tg-g-T96736-Ag | RHOA VLP (virus-like particle) |
| ORF Viral Vector | pGMLP005662 | Human RHOA Lentivirus plasmid |
| ORF Viral Vector | pGMLV000967 | Human RHOA Lentivirus plasmid |
| ORF Viral Vector | pGMLV001080 | Human RHOA Lentivirus plasmid |
| ORF Viral Vector | pGMLV001496 | Human RHOA Lentivirus plasmid |
| ORF Viral Vector | pGMAP000445 | Human RHOA Adenovirus plasmid |
| ORF Viral Vector | pGMAP000543 | Human RHOA Adenovirus plasmid |
| ORF Viral Vector | pGMLP-SPh-067 | Human RHOA Lentivirus plasmid |
| ORF Viral Vector | pGMAP-SPh-207 | Human RHOA Adenovirus plasmid |
| ORF Viral Vector | pGMPC000595 | Human RHOA Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001816 | Human RHOA Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP005662 | Human RHOA Lentivirus particle |
| ORF Viral Vector | vGMLV000967 | Human RHOA Lentivirus particle |
| ORF Viral Vector | vGMLV001080 | Human RHOA Lentivirus particle |
| ORF Viral Vector | vGMLV001496 | Human RHOA Lentivirus particle |
| ORF Viral Vector | vGMAP000445 | Human RHOA Adenovirus particle |
| ORF Viral Vector | vGMAP000543 | Human RHOA Adenovirus particle |
| ORF Viral Vector | vGMLP-SPh-067 | Human RHOA Lentivirus particle |
| ORF Viral Vector | vGMAP-SPh-207 | Human RHOA Adenovirus particle |
Target information
| Target ID | GM-T96736 |
| Target Name | RHOA |
| Gene ID | 387, 11848, 706455, 117273, 101084011, 403954, 338049, 100053343 |
| Gene Symbol and Synonyms | ARH12,ARHA,Arha1,Arha2,EDFAOB,RHO1,RHO12,RHOA,RHOH12 |
| Uniprot Accession | P61586 |
| Uniprot Entry Name | RHOA_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | Breast Cancer |
| Gene Ensembl | ENSG00000067560 |
| Target Classification | Not Available |
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


