Human IFNG/IFG/IFI ORF/cDNA clone-Lentivirus plasmid (NM_000619)

Cat. No.: pGMLP000461
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IFNG/IFG/IFI Lentiviral expression plasmid for IFNG lentivirus packaging, IFNG lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IFNG/IFG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $425.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000461
Gene Name IFNG
Accession Number NM_000619
Gene ID 3458
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 501 bp
Gene Alias IFG,IFI
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAATATACAAGTTATATCTTGGCTTTTCAGCTCTGCATCGTTTTGGGTTCTCTTGGCTGTTACTGCCAGGACCCATATGTAAAAGAAGCAGAAAACCTTAAGAAATATTTTAATGCAGGTCATTCAGATGTAGCGGATAATGGAACTCTTTTCTTAGGCATTTTGAAGAATTGGAAAGAGGAGAGTGACAGAAAAATAATGCAGAGCCAAATTGTCTCCTTTTACTTCAAACTTTTTAAAAACTTTAAAGATGACCAGAGCATCCAAAAGAGTGTGGAGACCATCAAGGAAGACATGAATGTCAAGTTTTTCAATAGCAACAAAAAGAAACGAGATGACTTCGAAAAGCTGACTAATTATTCGGTAACTGACTTGAATGTCCAACGCAAAGCAATACATGAACTCATCCAAGTGATGGCTGAACTGTCGCCAGCAGCTAAAACAGGGAAGCGAAAAAGGAGTCAGATGCTGTTTCGAGGTCGAAGAGCATCCCAGTAA
ORF Protein Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-175 Pre-Made Emapalumab biosimilar, Whole mAb, Anti-IFNG Antibody: Anti-IFG/IFI/IMD69 therapeutic antibody
    Biosimilar GMP-Bios-ab-219 Pre-Made Fontolizumab biosimilar, Whole mAb, Anti-IFNG Antibody: Anti-IFG/IFI/IMD69 therapeutic antibody
    Target Antibody GM-Tg-g-T77664-Ab Anti-IFNG/ IFG/ IFI functional antibody
    Target Antigen GM-Tg-g-T77664-Ag IFNG protein
    Cytokine cks-Tg-g-GM-T77664 interferon, gamma (IFNG) protein & antibody
    ORF Viral Vector pGMLP000461 Human IFNG Lentivirus plasmid
    ORF Viral Vector pGMAD000575 Human IFNG Adenovirus plasmid
    ORF Viral Vector pGMAP000297 Human IFNG Adenovirus plasmid
    ORF Viral Vector pGMPC004769 Human IFNG Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000461 Human IFNG Lentivirus particle
    ORF Viral Vector vGMAD000575 Human IFNG Adenovirus particle
    ORF Viral Vector vGMAP000297 Human IFNG Adenovirus particle


    Target information

    Target ID GM-T77664
    Target Name IFNG
    Gene ID 3458, 15978, 574282, 25712, 493965, 403801, 281237, 100034181
    Gene Symbol and Synonyms If2f,IFG,IFI,IFN-g,IFN-gamma,IFNG,IFNG2,IMD69
    Uniprot Accession P01579
    Uniprot Entry Name IFNG_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target
    Disease Breast Cancer
    Gene Ensembl ENSG00000111537
    Target Classification Checkpoint-Immuno Oncology

    This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.