Human IFNG/IFG/IFI ORF/cDNA clone-Adenovirus particle (BC070256)

Cat. No.: vGMAP000297

Pre-made Human IFNG/IFG/IFI Adenovirus for IFNG overexpression in-vitro and in-vivo. The IFNG adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IFNG-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to IFNG/IFG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000297 Human IFNG Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000297
Gene Name IFNG
Accession Number BC070256
Gene ID 3458
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 501 bp
Gene Alias IFG,IFI
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAAATATACAAGTTATATCTTGGCTTTTCAGCTCTGCATCGTTTTGGGTTCTCTTGGCTGTTACTGCCAGGACCCATATGTAAAAGAAGCAGAAAACCTTAAGAAATATTTTAATGCAGGTCATTCAGATGTAGCGGATAATGGAACTCTTTTCTTAGGCATTTTGAAGAATTGGAAAGAGGAGAGTGACAGAAAAATAATGCAGAGCCAAATTGTCTCCTTTTACTTCAAACTTTTTAAAAACTTTAAAGATGACCAGAGCATCCAAAAGAGTGTGGAGACCATCAAGGAAGACATGAATGTCAAGTTTTTCAATAGCAACAAAAAGAAACGAGATGACTTCGAAAAGCTGACTAATTATTCGGTAACTGACTTGAATGTCCAACGCAAAGCAATACATGAACTCATCCAAGTGATGGCTGAACTGTCGCCAGCAGCTAAAACAGGGAAGCGAAAAAGGAGTCAGATGCTGTTTCGAGGTCGAAGAGCATCCCAGTAA
ORF Protein Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-175 Pre-Made Emapalumab biosimilar, Whole mAb, Anti-IFNG Antibody: Anti-IFG/IFI/IMD69 therapeutic antibody
    Biosimilar GMP-Bios-ab-219 Pre-Made Fontolizumab biosimilar, Whole mAb, Anti-IFNG Antibody: Anti-IFG/IFI/IMD69 therapeutic antibody
    Target Antibody GM-Tg-g-T77664-Ab Anti-IFNG/ IFG/ IFI functional antibody
    Target Antigen GM-Tg-g-T77664-Ag IFNG protein
    Cytokine cks-Tg-g-GM-T77664 interferon, gamma (IFNG) protein & antibody
    ORF Viral Vector pGMLP000461 Human IFNG Lentivirus plasmid
    ORF Viral Vector pGMAD000575 Human IFNG Adenovirus plasmid
    ORF Viral Vector pGMAP000297 Human IFNG Adenovirus plasmid
    ORF Viral Vector pGMPC004769 Human IFNG Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000461 Human IFNG Lentivirus particle
    ORF Viral Vector vGMAD000575 Human IFNG Adenovirus particle
    ORF Viral Vector vGMAP000297 Human IFNG Adenovirus particle


    Target information

    Target ID GM-T77664
    Target Name IFNG
    Gene ID 3458, 15978, 574282, 25712, 493965, 403801, 281237, 100034181
    Gene Symbol and Synonyms If2f,IFG,IFI,IFN-g,IFN-gamma,IFNG,IFNG2,IMD69
    Uniprot Accession P01579
    Uniprot Entry Name IFNG_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target
    Disease Breast Cancer
    Gene Ensembl ENSG00000111537
    Target Classification Checkpoint-Immuno Oncology

    This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.