Human PTHLH/BDE2/HHM ORF/cDNA clone-Lentivirus plasmid (NM_002820)

Cat. No.: pGMLP000529
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PTHLH/BDE2/HHM Lentiviral expression plasmid for PTHLH lentivirus packaging, PTHLH lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PTHLH/BDE2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $432
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000529
Gene Name PTHLH
Accession Number NM_002820
Gene ID 5744
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 528 bp
Gene Alias BDE2,HHM,PLP,PTHR,PTHRP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGCGGAGACTGGTTCAGCAGTGGAGCGTCGCGGTGTTCCTGCTGAGCTACGCGGTGCCCTCCTGCGGGCGCTCGGTGGAGGGTCTCAGCCGCCGCCTCAAAAGAGCTGTGTCTGAACATCAGCTCCTCCATGACAAGGGGAAGTCCATCCAAGATTTACGGCGACGATTCTTCCTTCACCATCTGATCGCAGAAATCCACACAGCTGAAATCAGAGCTACCTCGGAGGTGTCCCCTAACTCCAAGCCCTCTCCCAACACAAAGAACCACCCCGTCCGATTTGGGTCTGATGATGAGGGCAGATACCTAACTCAGGAAACTAACAAGGTGGAGACGTACAAAGAGCAGCCGCTCAAGACACCTGGGAAGAAAAAGAAAGGCAAGCCCGGGAAACGCAAGGAGCAGGAAAAGAAAAAACGGCGAACTCGCTCTGCCTGGTTAGACTCTGGAGTGACTGGGAGTGGGCTAGAAGGGGACCACCTGTCTGACACCTCCACAACGTCGCTGGAGCTCGATTCACGGTAA
ORF Protein Sequence MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1230-Ab Anti-PTHR/ PTHLH/ BDE2 functional antibody
    Target Antigen GM-Tg-g-SE1230-Ag PTHLH protein
    ORF Viral Vector pGMLP000529 Human PTHLH Lentivirus plasmid
    ORF Viral Vector pGMLV001901 Human PTHLH Lentivirus plasmid
    ORF Viral Vector pGMAP000211 Human PTHLH Adenovirus plasmid
    ORF Viral Vector vGMLP000529 Human PTHLH Lentivirus particle
    ORF Viral Vector vGMLV001901 Human PTHLH Lentivirus particle
    ORF Viral Vector vGMAP000211 Human PTHLH Adenovirus particle


    Target information

    Target ID GM-SE1230
    Target Name PTHLH
    Gene ID 5744, 19227, 710295, 24695, 554222, 403987, 286767, 100033979
    Gene Symbol and Synonyms BDE2,HHM,PLP,PTH-like,PTHLH,PTHR,PTHRP
    Uniprot Accession P12272
    Uniprot Entry Name PTHR_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Lung cancer
    Gene Ensembl ENSG00000087494
    Target Classification Not Available

    The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone. [provided by RefSeq, Nov 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.