Human TMEM127 ORF/cDNA clone-Lentivirus plasmid (NM_017849)

Cat. No.: pGMLP000811
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM127/ Lentiviral expression plasmid for TMEM127 lentivirus packaging, TMEM127 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TMEM127/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $479.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000811
Gene Name TMEM127
Accession Number NM_017849
Gene ID 55654
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 717 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTACGCCCCCGGAGGCGCAGGGCTGCCCGGCGGGCGCCGGCGGAGGAGCCCGGGAGGCAGCGCTCTGCCCAAGCAGCCGGAGCGTAGCCTGGCCTCGGCCCTGCCTGGCGCCCTGTCTATCACGGCGCTGTGCACTGCCCTCGCCGAGCCCGCCTGGTTGCACATCCACGGAGGCACCTGTTCGCGCCAGGAGCTGGGGGTCTCCGACGTGTTGGGCTATGTGCACCCGGACCTGCTGAAAGATTTCTGCATGAATCCCCAGACAGTGCTGCTCCTGCGGGTCATCGCCGCCTTCTGTTTCCTGGGCATCCTGTGTAGTCTCTCCGCTTTCCTTCTGGATGTCTTTGGGCCGAAGCATCCTGCTCTGAAGATCACTCGTCGCTATGCCTTCGCCCATATCCTAACGGTTCTGCAGTGTGCCACCGTCATTGGCTTTTCTTATTGGGCTTCTGAACTCATCTTGGCCCAGCAGCAGCAGCATAAGAAGTACCATGGATCCCAGGTCTATGTCACCTTCGCCGTTAGCTTCTACCTGGTGGCAGGAGCTGGTGGAGCCTCAATCCTGGCCACGGCAGCCAACCTCCTGCGCCACTACCCCACAGAGGAAGAGGAGCAGGCGCTGGAGCTGCTCTCAGAGATGGAAGAGAACGAGCCCTACCCGGCGGAATATGAGGTCATCAACCAGTTCCAGCCACCCCCTGCTTACACACCCTAA
ORF Protein Sequence MYAPGGAGLPGGRRRRSPGGSALPKQPERSLASALPGALSITALCTALAEPAWLHIHGGTCSRQELGVSDVLGYVHPDLLKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLVAGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1818-Ab Anti-TM127/ TMEM127 monoclonal antibody
    Target Antigen GM-Tg-g-MP1818-Ag TMEM127 VLP (virus-like particle)
    ORF Viral Vector pGMLP000811 Human TMEM127 Lentivirus plasmid
    ORF Viral Vector pGMPC000946 Human TMEM127 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000811 Human TMEM127 Lentivirus particle


    Target information

    Target ID GM-MP1818
    Target Name TMEM127
    Gene ID 55654, 69470, 705069, 311405, 101091188, 609057, 513620, 100062454
    Gene Symbol and Synonyms 2310003P10Rik,RGD1309744,TMEM127
    Uniprot Accession O75204
    Uniprot Entry Name TM127_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000135956
    Target Classification Not Available

    This gene encodes a transmembrane protein with 3 predicted transmembrane domains. The protein is associated with a subpopulation of vesicular organelles corresponding to early endosomal structures, with the Golgi, and with lysosomes, and may participate in protein trafficking between these structures. Mutations in this gene and several other genes cause pheochromocytomas. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.