Human TMEM127 ORF/cDNA clone-Lentivirus particle (NM_017849)
Cat. No.: vGMLP000811
Pre-made Human TMEM127/ Lentiviral expression plasmid for TMEM127 lentivirus packaging, TMEM127 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
TMEM127/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP000811 | Human TMEM127 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP000811 |
| Gene Name | TMEM127 |
| Accession Number | NM_017849 |
| Gene ID | 55654 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 717 bp |
| Gene Alias | |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTACGCCCCCGGAGGCGCAGGGCTGCCCGGCGGGCGCCGGCGGAGGAGCCCGGGAGGCAGCGCTCTGCCCAAGCAGCCGGAGCGTAGCCTGGCCTCGGCCCTGCCTGGCGCCCTGTCTATCACGGCGCTGTGCACTGCCCTCGCCGAGCCCGCCTGGTTGCACATCCACGGAGGCACCTGTTCGCGCCAGGAGCTGGGGGTCTCCGACGTGTTGGGCTATGTGCACCCGGACCTGCTGAAAGATTTCTGCATGAATCCCCAGACAGTGCTGCTCCTGCGGGTCATCGCCGCCTTCTGTTTCCTGGGCATCCTGTGTAGTCTCTCCGCTTTCCTTCTGGATGTCTTTGGGCCGAAGCATCCTGCTCTGAAGATCACTCGTCGCTATGCCTTCGCCCATATCCTAACGGTTCTGCAGTGTGCCACCGTCATTGGCTTTTCTTATTGGGCTTCTGAACTCATCTTGGCCCAGCAGCAGCAGCATAAGAAGTACCATGGATCCCAGGTCTATGTCACCTTCGCCGTTAGCTTCTACCTGGTGGCAGGAGCTGGTGGAGCCTCAATCCTGGCCACGGCAGCCAACCTCCTGCGCCACTACCCCACAGAGGAAGAGGAGCAGGCGCTGGAGCTGCTCTCAGAGATGGAAGAGAACGAGCCCTACCCGGCGGAATATGAGGTCATCAACCAGTTCCAGCCACCCCCTGCTTACACACCCTAA |
| ORF Protein Sequence | MYAPGGAGLPGGRRRRSPGGSALPKQPERSLASALPGALSITALCTALAEPAWLHIHGGTCSRQELGVSDVLGYVHPDLLKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLVAGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP1818-Ab | Anti-TM127/ TMEM127 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP1818-Ag | TMEM127 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000811 | Human TMEM127 Lentivirus plasmid |
| ORF Viral Vector | pGMPC000946 | Human TMEM127 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000811 | Human TMEM127 Lentivirus particle |
Target information
| Target ID | GM-MP1818 |
| Target Name | TMEM127 |
| Gene ID | 55654, 69470, 705069, 311405, 101091188, 609057, 513620, 100062454 |
| Gene Symbol and Synonyms | 2310003P10Rik,RGD1309744,TMEM127 |
| Uniprot Accession | O75204 |
| Uniprot Entry Name | TM127_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000135956 |
| Target Classification | Not Available |
This gene encodes a transmembrane protein with 3 predicted transmembrane domains. The protein is associated with a subpopulation of vesicular organelles corresponding to early endosomal structures, with the Golgi, and with lysosomes, and may participate in protein trafficking between these structures. Mutations in this gene and several other genes cause pheochromocytomas. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2010]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


