Human DEGS1/DEGS/DEGS-1 ORF/cDNA clone-Lentivirus plasmid (NM_003676)
Cat. No.: pGMLP002078
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human DEGS1/DEGS/DEGS-1 Lentiviral expression plasmid for DEGS1 lentivirus packaging, DEGS1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
DEGS1/DEGS products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP002078 |
Gene Name | DEGS1 |
Accession Number | NM_003676 |
Gene ID | 8560 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 972 bp |
Gene Alias | DEGS,DEGS-1,Des-1,DES1,FADS7,MIG15,MLD |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGGAGCCGCGTCTCGCGGGAAGACTTCGAGTGGGTCTACACCGACCAGCCGCACGCCGACCGGCGCCGGGAGATCCTGGCAAAGTATCCAGAGATAAAGTCCTTGATGAAACCTGATCCCAATTTGATATGGATTATAATTATGATGGTTCTCACCCAGTTGGGTGCATTTTACATAGTAAAAGACTTGGACTGGAAATGGGTCATATTTGGGGCCTATGCGTTTGGCAGTTGCATTAACCACTCAATGACTCTGGCTATTCATGAGATTGCCCACAATGCTGCCTTTGGCAACTGCAAAGCAATGTGGAATCGCTGGTTTGGAATGTTTGCTAATCTTCCTATTGGGATTCCATATTCAATTTCCTTTAAGAGGTATCACATGGATCATCATCGGTACCTTGGAGCTGATGGCGTCGATGTAGATATTCCTACCGATTTTGAGGGCTGGTTCTTCTGTACCGCTTTCAGAAAGTTTATATGGGTTATTCTTCAGCCTCTCTTTTATGCCTTTCGACCTCTGTTCATCAACCCCAAACCAATTACGTATCTGGAAGTTATCAATACCGTGGCACAGGTCACTTTTGACATTTTAATTTATTACTTTTTGGGAATTAAATCCTTAGTCTACATGTTGGCAGCATCTTTACTTGGCCTGGGTTTGCACCCAATTTCTGGACATTTTATAGCTGAGCATTACATGTTCTTAAAGGGTCATGAAACTTACTCATATTATGGGCCTCTGAATTTACTTACCTTCAATGTGGGTTATCATAATGAACATCATGATTTCCCCAACATTCCTGGAAAAAGTCTTCCACTGGTGAGGAAAATAGCAGCTGAATACTATGACAACCTCCCTCACTACAATTCCTGGATAAAAGTACTGTATGATTTTGTGATGGATGATACAATAAGTCCCTACTCAAGAATGAAGAGGCACCAAAAAGGAGAGATGGTGCTGGAGTAA |
ORF Protein Sequence | MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0355-Ab | Anti-DEGS1/ DEGS/ DEGS-1 monoclonal antibody |
Target Antigen | GM-Tg-g-MP0355-Ag | DEGS1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP002078 | Human DEGS1 Lentivirus plasmid |
ORF Viral Vector | vGMLP002078 | Human DEGS1 Lentivirus particle |
Target information
Target ID | GM-MP0355 |
Target Name | DEGS1 |
Gene ID | 8560, 13244, 702128, 101083993, 490395, 507290, 100055442 |
Gene Symbol and Synonyms | DEGS,DEGS-1,DEGS1,Des-1,DES1,FADS7,HLD18,Mdes,MIG15,MLD |
Uniprot Accession | O15121 |
Uniprot Entry Name | DEGS1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000143753 |
Target Classification | Not Available |
This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. [provided by RefSeq, Mar 2010]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.