Human DEGS1/DEGS/DEGS-1 ORF/cDNA clone-Lentivirus particle (NM_003676)

Cat. No.: vGMLP002078

Pre-made Human DEGS1/DEGS/DEGS-1 Lentiviral expression plasmid for DEGS1 lentivirus packaging, DEGS1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to DEGS1/DEGS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002078 Human DEGS1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002078
Gene Name DEGS1
Accession Number NM_003676
Gene ID 8560
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 972 bp
Gene Alias DEGS,DEGS-1,Des-1,DES1,FADS7,MIG15,MLD
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGAGCCGCGTCTCGCGGGAAGACTTCGAGTGGGTCTACACCGACCAGCCGCACGCCGACCGGCGCCGGGAGATCCTGGCAAAGTATCCAGAGATAAAGTCCTTGATGAAACCTGATCCCAATTTGATATGGATTATAATTATGATGGTTCTCACCCAGTTGGGTGCATTTTACATAGTAAAAGACTTGGACTGGAAATGGGTCATATTTGGGGCCTATGCGTTTGGCAGTTGCATTAACCACTCAATGACTCTGGCTATTCATGAGATTGCCCACAATGCTGCCTTTGGCAACTGCAAAGCAATGTGGAATCGCTGGTTTGGAATGTTTGCTAATCTTCCTATTGGGATTCCATATTCAATTTCCTTTAAGAGGTATCACATGGATCATCATCGGTACCTTGGAGCTGATGGCGTCGATGTAGATATTCCTACCGATTTTGAGGGCTGGTTCTTCTGTACCGCTTTCAGAAAGTTTATATGGGTTATTCTTCAGCCTCTCTTTTATGCCTTTCGACCTCTGTTCATCAACCCCAAACCAATTACGTATCTGGAAGTTATCAATACCGTGGCACAGGTCACTTTTGACATTTTAATTTATTACTTTTTGGGAATTAAATCCTTAGTCTACATGTTGGCAGCATCTTTACTTGGCCTGGGTTTGCACCCAATTTCTGGACATTTTATAGCTGAGCATTACATGTTCTTAAAGGGTCATGAAACTTACTCATATTATGGGCCTCTGAATTTACTTACCTTCAATGTGGGTTATCATAATGAACATCATGATTTCCCCAACATTCCTGGAAAAAGTCTTCCACTGGTGAGGAAAATAGCAGCTGAATACTATGACAACCTCCCTCACTACAATTCCTGGATAAAAGTACTGTATGATTTTGTGATGGATGATACAATAAGTCCCTACTCAAGAATGAAGAGGCACCAAAAAGGAGAGATGGTGCTGGAGTAA
ORF Protein Sequence MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0355-Ab Anti-DEGS1/ DEGS/ DEGS-1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0355-Ag DEGS1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002078 Human DEGS1 Lentivirus plasmid
    ORF Viral Vector vGMLP002078 Human DEGS1 Lentivirus particle


    Target information

    Target ID GM-MP0355
    Target Name DEGS1
    Gene ID 8560, 13244, 702128, 101083993, 490395, 507290, 100055442
    Gene Symbol and Synonyms DEGS,DEGS-1,DEGS1,Des-1,DES1,FADS7,HLD18,Mdes,MIG15,MLD
    Uniprot Accession O15121
    Uniprot Entry Name DEGS1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000143753
    Target Classification Not Available

    This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. [provided by RefSeq, Mar 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.