Human DPT/TRAMP ORF/cDNA clone-Lentivirus plasmid (NM_001937)

Cat. No.: pGMLP003439
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DPT/TRAMP Lentiviral expression plasmid for DPT lentivirus packaging, DPT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to DPT/TRAMP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $451.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP003439
Gene Name DPT
Accession Number NM_001937
Gene ID 1805
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 606 bp
Gene Alias TRAMP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACCTCAGTCTTCTCTGGGTACTTCTGCCCCTAGTCACCATGGCCTGGGGCCAGTATGGCGATTATGGATACCCATACCAGCAGTATCATGACTACAGCGATGATGGGTGGGTGAATTTGAACCGGCAAGGCTTCAGCTACCAGTGTCCCCAGGGGCAGGTGATAGTGGCCGTGAGGAGCATCTTCAGCAAGAAGGAAGGTTCTGACAGACAATGGAACTACGCCTGCATGCCCACGCCACAGAGCCTCGGGGAACCCACGGAGTGCTGGTGGGAGGAGATCAACAGGGCTGGCATGGAATGGTACCAGACGTGCTCCAACAATGGGCTGGTGGCAGGATTCCAGAGCCGCTACTTCGAGTCAGTGCTGGATCGGGAGTGGCAGTTTTACTGTTGTCGCTACAGCAAGAGGTGCCCATATTCCTGCTGGCTAACAACAGAATATCCAGGTCACTATGGTGAGGAAATGGACATGATTTCCTACAATTATGATTACTATATCCGAGGAGCAACAACCACTTTCTCTGCAGTGGAAAGGGATCGCCAGTGGAAGTTCATAATGTGCCGGATGACTGAATACGACTGTGAATTTGCAAATGTTTAG
ORF Protein Sequence MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0894-Ab Anti-DERM/ DPT/ TRAMP functional antibody
    Target Antigen GM-Tg-g-SE0894-Ag DPT protein
    ORF Viral Vector pGMLP003439 Human DPT Lentivirus plasmid
    ORF Viral Vector pGMLP004017 Human DPT Lentivirus plasmid
    ORF Viral Vector vGMLP003439 Human DPT Lentivirus particle
    ORF Viral Vector vGMLP004017 Human DPT Lentivirus particle


    Target information

    Target ID GM-SE0894
    Target Name DPT
    Gene ID 1805, 56429, 700181, 289178, 101101023, 490355, 504963, 100057735
    Gene Symbol and Synonyms 1810032B19Rik,5033416F05Rik,DPT,EQ-1,Eq1,TRAMP
    Uniprot Accession Q07507
    Uniprot Entry Name DERM_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000143196
    Target Classification Not Available

    Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.