Human DPT/TRAMP ORF/cDNA clone-Lentivirus plasmid (BC033736)
Cat. No.: pGMLP004017
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human DPT/TRAMP Lentiviral expression plasmid for DPT lentivirus packaging, DPT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
DPT/TRAMP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004017 |
Gene Name | DPT |
Accession Number | BC033736 |
Gene ID | 1805 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 606 bp |
Gene Alias | TRAMP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACCTCAGTCTTCTCTGGGTACTTCTGCCCCTAGTCACCATGGCCTGGGGCCAGTATGGCGATTATGGATACCCATACCAGCAGTATCATGACTACAGCGATGATGGGTGGGTGAATTTGAACCGGCAAGGCTTCAGCTACCAGTGTCCCCAGGGGCAGGTGATAGTGGCCGTGAGGAGCATCTTCAGCAAGAAGGAAGGTTCTGACAGACAATGGAACTACGCCTGCATGCCCACACCACAGAGCCTCGGGGAACCCACGGAGTGCTGGTGGGAGGAGATCAACAGGGCTGGCATGGAATGGTACCAGACGTGCTCCAACAATGGGCTGGTGGCAGGATTCCAGAGCCGCTACTTCGAGTCAGTGCTGGATCGGGAGTGGCAGTTTTACTGTTGTCGCTACAGCAAGAGGTGCCCATATTCCTGCTGGCTAACAATAGAATATCCAGGTCACTATGGTGAGGAAATGGACATGATTTCCTACAATTATGATTACTATATCCGAGGAGCAACAACCACTTTCTCTGCAGTGGAAAGGGATCGCCAGTGGAAGTTCATAATGTGCCGGATGACTGAATACGACTGTGAATTTGCAAATGTTTAG |
ORF Protein Sequence | MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0894-Ab | Anti-DERM/ DPT/ TRAMP functional antibody |
Target Antigen | GM-Tg-g-SE0894-Ag | DPT protein |
ORF Viral Vector | pGMLP003439 | Human DPT Lentivirus plasmid |
ORF Viral Vector | pGMLP004017 | Human DPT Lentivirus plasmid |
ORF Viral Vector | vGMLP003439 | Human DPT Lentivirus particle |
ORF Viral Vector | vGMLP004017 | Human DPT Lentivirus particle |
Target information
Target ID | GM-SE0894 |
Target Name | DPT |
Gene ID | 1805, 56429, 700181, 289178, 101101023, 490355, 504963, 100057735 |
Gene Symbol and Synonyms | 1810032B19Rik,5033416F05Rik,DPT,EQ-1,Eq1,TRAMP |
Uniprot Accession | Q07507 |
Uniprot Entry Name | DERM_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000143196 |
Target Classification | Not Available |
Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.