Human DPT/TRAMP ORF/cDNA clone-Lentivirus particle (NM_001937)
Cat. No.: vGMLP003439
Pre-made Human DPT/TRAMP Lentiviral expression plasmid for DPT lentivirus packaging, DPT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
DPT/TRAMP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP003439 | Human DPT Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP003439 |
Gene Name | DPT |
Accession Number | NM_001937 |
Gene ID | 1805 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 606 bp |
Gene Alias | TRAMP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACCTCAGTCTTCTCTGGGTACTTCTGCCCCTAGTCACCATGGCCTGGGGCCAGTATGGCGATTATGGATACCCATACCAGCAGTATCATGACTACAGCGATGATGGGTGGGTGAATTTGAACCGGCAAGGCTTCAGCTACCAGTGTCCCCAGGGGCAGGTGATAGTGGCCGTGAGGAGCATCTTCAGCAAGAAGGAAGGTTCTGACAGACAATGGAACTACGCCTGCATGCCCACGCCACAGAGCCTCGGGGAACCCACGGAGTGCTGGTGGGAGGAGATCAACAGGGCTGGCATGGAATGGTACCAGACGTGCTCCAACAATGGGCTGGTGGCAGGATTCCAGAGCCGCTACTTCGAGTCAGTGCTGGATCGGGAGTGGCAGTTTTACTGTTGTCGCTACAGCAAGAGGTGCCCATATTCCTGCTGGCTAACAACAGAATATCCAGGTCACTATGGTGAGGAAATGGACATGATTTCCTACAATTATGATTACTATATCCGAGGAGCAACAACCACTTTCTCTGCAGTGGAAAGGGATCGCCAGTGGAAGTTCATAATGTGCCGGATGACTGAATACGACTGTGAATTTGCAAATGTTTAG |
ORF Protein Sequence | MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0894-Ab | Anti-DERM/ DPT/ TRAMP functional antibody |
Target Antigen | GM-Tg-g-SE0894-Ag | DPT protein |
ORF Viral Vector | pGMLP003439 | Human DPT Lentivirus plasmid |
ORF Viral Vector | pGMLP004017 | Human DPT Lentivirus plasmid |
ORF Viral Vector | vGMLP003439 | Human DPT Lentivirus particle |
ORF Viral Vector | vGMLP004017 | Human DPT Lentivirus particle |
Target information
Target ID | GM-SE0894 |
Target Name | DPT |
Gene ID | 1805, 56429, 700181, 289178, 101101023, 490355, 504963, 100057735 |
Gene Symbol and Synonyms | 1810032B19Rik,5033416F05Rik,DPT,EQ-1,Eq1,TRAMP |
Uniprot Accession | Q07507 |
Uniprot Entry Name | DERM_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000143196 |
Target Classification | Not Available |
Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.