Human PPP1CB/HEL-S-80p/MP ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_206876)

Cat. No.: pGMPC000521
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PPP1CB/HEL-S-80p/MP Non-Viral expression plasmid (overexpression vector) for mouse PPP1CB overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to PPP1CB/HEL-S-80p products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000521
Gene Name PPP1CB
Accession Number NM_206876
Gene ID 5500
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 984 bp
Gene Alias HEL-S-80p,MP,NSLH2,PP-1B,PP1B,PP1beta,PP1c,PPP1beta,PPP1CD
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGACGGGGAGCTGAACGTGGACAGCCTCATCACCCGGCTGCTGGAGGTACGAGGATGTCGTCCAGGAAAGATTGTGCAGATGACTGAAGCAGAAGTTCGAGGCTTATGTATCAAGTCTCGGGAGATCTTTCTCAGCCAGCCTATTCTTTTGGAATTGGAAGCACCGCTGAAAATTTGTGGAGATATTCATGGACAATATACAGATTTACTGAGATTATTTGAATATGGAGGTTTCCCACCAGAAGCCAACTATCTTTTCTTAGGAGATTATGTGGACAGAGGAAAGCAGTCTTTGGAAACCATTTGTTTGCTATTGGCTTATAAAATCAAATATCCAGAGAACTTCTTTCTCTTAAGAGGAAACCATGAGTGTGCTAGCATCAATCGCATTTATGGATTCTATGATGAATGCAAACGAAGATTTAATATTAAATTGTGGAAGACCTTCACTGATTGTTTTAACTGTCTGCCTATAGCAGCCATTGTGGATGAGAAGATCTTCTGTTGTCATGGAGGATTGTCACCAGACCTGCAATCTATGGAGCAGATTCGGAGAATTATGAGACCTACTGATGTCCCTGATACAGGTTTGCTCTGTGATTTGCTATGGTCTGATCCAGATAAGGATGTGCAAGGCTGGGGAGAAAATGATCGTGGTGTTTCCTTTACTTTTGGAGCTGATGTAGTCAGTAAATTTCTGAATCGTCATGATTTAGATTTGATTTGTCGAGCTCATCAGGTGGTGGAAGATGGATATGAATTTTTTGCTAAACGACAGTTGGTAACCTTATTTTCAGCCCCAAATTACTGTGGCGAGTTTGATAATGCTGGTGGAATGATGAGTGTGGATGAAACTTTGATGTGTTCATTTCAGATATTGAAACCATCTGAAAAGAAAGCTAAATACCAGTATGGTGGACTGAATTCTGGACGTCCTGTCACTCCACCTCGAACAGCTAATCCGCCGAAGAAAAGGTGA
ORF Protein Sequence MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2262-Ab Anti-PP1B/ PPP1CB/ HEL-S-80p monoclonal antibody
    Target Antigen GM-Tg-g-MP2262-Ag PPP1CB VLP (virus-like particle)
    ORF Viral Vector pGMLP002269 Human PPP1CB Lentivirus plasmid
    ORF Viral Vector pGMPC000521 Human PPP1CB Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000587 Human PPP1CB Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002269 Human PPP1CB Lentivirus particle


    Target information

    Target ID GM-MP2262
    Target Name PPP1CB
    Gene ID 5500, 19046, 703302, 25594, 101092932, 403558, 538829, 100071067
    Gene Symbol and Synonyms 1200010B19,HEL-S-80p,MP,NSLH2,PP-1B,PP1B,PP1beta,PP1c,PPP1beta,PPP1CB,PPP1CD
    Uniprot Accession P62140
    Uniprot Entry Name PP1B_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000213639
    Target Classification Not Available

    The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.