Human PPP1CB/HEL-S-80p/NSLH2 ORF/cDNA clone-Lentivirus particle (NM_206876)
Cat. No.: vGMLP002269
Pre-made Human PPP1CB/HEL-S-80p/NSLH2 Lentiviral expression plasmid for PPP1CB lentivirus packaging, PPP1CB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PPP1CB/HEL-S-80p products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP002269 | Human PPP1CB Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP002269 |
Gene Name | PPP1CB |
Accession Number | NM_206876 |
Gene ID | 5500 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 984 bp |
Gene Alias | HEL-S-80p,NSLH2,PP-1B,PP1B,PP1beta,PPP1CD |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCGGACGGGGAGCTGAACGTGGACAGCCTCATCACCCGGCTGCTGGAGGTACGAGGATGTCGTCCAGGAAAGATTGTGCAGATGACTGAAGCAGAAGTTCGAGGCTTATGTATCAAGTCTCGGGAGATCTTTCTCAGCCAGCCTATTCTTTTGGAATTGGAAGCACCGCTGAAAATTTGTGGAGATATTCATGGACAATATACAGATTTACTGAGATTATTTGAATATGGAGGTTTCCCACCAGAAGCCAACTATCTTTTCTTAGGAGATTATGTGGACAGAGGAAAGCAGTCTTTGGAAACCATTTGTTTGCTATTGGCTTATAAAATCAAATATCCAGAGAACTTCTTTCTCTTAAGAGGAAACCATGAGTGTGCTAGCATCAATCGCATTTATGGATTCTATGATGAATGCAAACGAAGATTTAATATTAAATTGTGGAAGACCTTCACTGATTGTTTTAACTGTCTGCCTATAGCAGCCATTGTGGATGAGAAGATCTTCTGTTGTCATGGAGGATTGTCACCAGACCTGCAATCTATGGAGCAGATTCGGAGAATTATGAGACCTACTGATGTCCCTGATACAGGTTTGCTCTGTGATTTGCTATGGTCTGATCCAGATAAGGATGTGCAAGGCTGGGGAGAAAATGATCGTGGTGTTTCCTTTACTTTTGGAGCTGATGTAGTCAGTAAATTTCTGAATCGTCATGATTTAGATTTGATTTGTCGAGCTCATCAGGTGGTGGAAGATGGATATGAATTTTTTGCTAAACGACAGTTGGTAACCTTATTTTCAGCCCCAAATTACTGTGGCGAGTTTGATAATGCTGGTGGAATGATGAGTGTGGATGAAACTTTGATGTGTTCATTTCAGATATTGAAACCATCTGAAAAGAAAGCTAAATACCAGTATGGTGGACTGAATTCTGGACGTCCTGTCACTCCACCTCGAACAGCTAATCCGCCGAAGAAAAGGTGA |
ORF Protein Sequence | MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP2262-Ab | Anti-PP1B/ PPP1CB/ HEL-S-80p monoclonal antibody |
Target Antigen | GM-Tg-g-MP2262-Ag | PPP1CB VLP (virus-like particle) |
ORF Viral Vector | pGMLP002269 | Human PPP1CB Lentivirus plasmid |
ORF Viral Vector | pGMPC000521 | Human PPP1CB Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC000587 | Human PPP1CB Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP002269 | Human PPP1CB Lentivirus particle |
Target information
Target ID | GM-MP2262 |
Target Name | PPP1CB |
Gene ID | 5500, 19046, 703302, 25594, 101092932, 403558, 538829, 100071067 |
Gene Symbol and Synonyms | 1200010B19,HEL-S-80p,MP,NSLH2,PP-1B,PP1B,PP1beta,PP1c,PPP1beta,PPP1CB,PPP1CD |
Uniprot Accession | P62140 |
Uniprot Entry Name | PP1B_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000213639 |
Target Classification | Not Available |
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.