Human GPR162/A-2/GRCA ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_014449.2)
Cat. No.: pGMPC000558
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human GPR162/A-2/GRCA Non-Viral expression plasmid (overexpression vector) for mouse GPR162 overexpression in unique cell transient transfection and stable cell line development.
Go to
GPR162/A-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC000558 |
Gene Name | GPR162 |
Accession Number | NM_014449.2 |
Gene ID | 27239 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 915 bp |
Gene Alias | A-2,GRCA |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Null |
Fusion Tag | MYC (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCTGAGCACTGGGGTGGTGAGCTTCTTCTCCCTCAAGTCGGACTCGGCGCCCCCCTGGATGGTGCTGGCTGTGCTGTGGTGCTCCATGGCACAGACGCTGCTGCTGCCCTCCTTCATCTGGTCCTGCGAGCGCTACCGCGCCGACGTGCGCACAGTGTGGGAGCAATGCGTGGCCATCATGTCTGAGGAGGATGGAGATGACGATGGGGGCTGTGACGACTATGCAGAGGGCCGAGTTTGCAAAGTTCGCTTTGATGCTAACGGAGCCACAGGACCAGGGAGCCGGGACCCCGCCCAGGTGAAGCTGCTGCCTGGAAGGCACATGCTCTTCCCTCCTCTTGAGAGAGTCCACTACTTACAGGTCCCCCTATCCCGGCGTCTGTCCCATGATGAGACAAACATCTTCTCTACCCCTCGGGAACCAGGCTCCTTCCTGCACAAGTGGTCATCCTCTGATGACATCCGGGTCCTCCCAGCCCAGAGCCGGGCCCTCGGGGGTCCTCCTGAGTACCTGGGACAAAGACACAGGTTGGAGGACGAGGAGGACGAGGAAGAGGCTGAAGGTGGGGGGCTGGCCAGCCTTCGCCAATTCTTGGAGAGTGGGGTTCTGGGGTCAGGTGGGGGACCCCCACGGGGTCCTGGCTTCTTCCGGGAGGAGATCACCACCTTCATCGATGAGACACCTCTGCCTTCTCCGACTGCCTCACCAGGGCACTCTCCTCGTCGGCCCCGGCCACTGGGCCTCTCACCCCGCCGACTCTCCCTTGGGTCCCCTGAGAGCAGAGCCGTTGGACTTCCTTTGGGACTAAGCGCAGGGAGACGCTGCTCCCTGACGGGGGGTGAAGAAAGTGCAAGGGCTTGGGGAGGATCCTGGGGCCCAGGCAACCCCATCTTTCCCCAGCTGACCCTGTGA |
ORF Protein Sequence | MLSTGVVSFFSLKSDSAPPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0521-Ab | Anti-GP162/ GPR162/ A-2 monoclonal antibody |
Target Antigen | GM-Tg-g-MP0521-Ag | GPR162 VLP (virus-like particle) |
ORF Viral Vector | pGMAP000236 | Human GPR162 Adenovirus plasmid |
ORF Viral Vector | pGMPC000558 | Human GPR162 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMAP000236 | Human GPR162 Adenovirus particle |
Target information
Target ID | GM-MP0521 |
Target Name | GPR162 |
Gene ID | 27239, 14788, 100428266, 362436, 101084547, 486719, 540410, 100146294 |
Gene Symbol and Synonyms | A-2,GPR162,GRCA |
Uniprot Accession | Q16538 |
Uniprot Entry Name | GP162_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000250510 |
Target Classification | GPCR |
This gene was identified upon genomic analysis of a gene-dense region at human chromosome 12p13. It appears to be mainly expressed in the brain; however, its function is not known. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.