Human GPR162/A-2/GRCA ORF/cDNA clone-Adenovirus plasmid (BC002353)

Cat. No.: pGMAP000236
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GPR162/A-2/GRCA adenoviral expression plasmid for GPR162 adenovirus packaging, GPR162 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to GPR162/A-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000236
Gene Name GPR162
Accession Number BC002353
Gene ID 27239
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 915 bp
Gene Alias A-2,GRCA
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGCTGAGCACTGGGGTGGTGAGCTTCTTCTCCCTCAAGTCGGACTCGGCGCCCCCCTGGATGGTGCTGGCTGTGCTGTGGTGCTCCATGGCACAGACGCTGCTGCTGCCCTCCTTCATCTGGTCCTGCGAGCGCTACCGCGCCGACGTGCGCACAGTGTGGGAGCAATGCGTGGCCATCATGTCTGAGGAGGATGGAGATGACGATGGGGGCTGTGACGACTATGCAGAGGGCCGAGTTTGCAAAGTTCGCTTTGATGCTAACGGAGCCACAGGACCAGGGAGCCGGGACCCCGCCCAGGTGAAGCTGCTGCCTGGAAGGCACATGCTCTTCCCTCCTCTTGAGAGAGTCCACTACTTACAGGTCCCCCTATCCCGGCGTCTGTCCCATGATGAGACAAACATCTTCTCTACCCCTCGGGAACCAGGCTCCTTCCTGCACAAGTGGTCATCCTCTGATGACATCCGGGTCCTCCCAGCCCAGAGCCGGGCCCTCGGGGGTCCTCCTGAGTACCTGGGACAAAGACACAGGTTGGAGGACGAGGAGGACGAGGAAGAGGCTGAAGGTGGGGGGCTGGCCAGCCTTCGCCAATTCTTGGAGAGTGGGGTTCTGGGGTCAGGTGGGGGACCCCCACGGGGTCCTGGCTTCTTCCGGGAGGAGATCACCACCTTCATCGATGAGACACCTCTGCCTTCTCCGACTGCCTCACCAGGGCACTCTCCTCGTCGGCCCCGGCCACTGGGCCTCTCACCCCGCCGACTCTCCCTTGGGTCCCCTGAGAGCAGAGCCGTTGGACTTCCTTTGGGACTAAGCGCAGGGAGACGCTGCTCCCTGACGGGGGGTGAAGAAAGTGCAAGGGCTTGGGGAGGATCCTGGGGCCCAGGCAACCCCATCTTTCCCCAGCTGACCCTGTGA
ORF Protein Sequence MLSTGVVSFFSLKSDSAPPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0521-Ab Anti-GP162/ GPR162/ A-2 monoclonal antibody
    Target Antigen GM-Tg-g-MP0521-Ag GPR162 VLP (virus-like particle)
    ORF Viral Vector pGMAP000236 Human GPR162 Adenovirus plasmid
    ORF Viral Vector pGMPC000558 Human GPR162 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMAP000236 Human GPR162 Adenovirus particle


    Target information

    Target ID GM-MP0521
    Target Name GPR162
    Gene ID 27239, 14788, 100428266, 362436, 101084547, 486719, 540410, 100146294
    Gene Symbol and Synonyms A-2,GPR162,GRCA
    Uniprot Accession Q16538
    Uniprot Entry Name GP162_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000250510
    Target Classification GPCR

    This gene was identified upon genomic analysis of a gene-dense region at human chromosome 12p13. It appears to be mainly expressed in the brain; however, its function is not known. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.