Human SVBP/CCDC23/NEDAHM ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_199342.4)

Cat. No.: pGMPC001860
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SVBP/CCDC23/NEDAHM Non-Viral expression plasmid (overexpression vector) for mouse SVBP overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SVBP/CCDC23 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001860
Gene Name SVBP
Accession Number NM_199342.4
Gene ID 374969
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 201 bp
Gene Alias CCDC23,NEDAHM
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATCCACCTGCACGTAAAGAAAAAACCAAAGTTAAAGAATCTGTCAGCAGAGTTGAGAAGGCCAAACAGAAATCAGCCCAGCAGGAGCTGAAGCAGAGACAAAGAGCAGAGATCTATGCCCTCAACAGAGTCATGACAGAACTGGAGCAGCAGCAGTTTGATGAGTTCTGTAAACAGATGCAGCCTCCTGGAGAATGA
ORF Protein Sequence MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1327-Ab Anti-SVBP/ CCDC23 functional antibody
    Target Antigen GM-Tg-g-SE1327-Ag SVBP protein
    ORF Viral Vector pGMAP000413 Human CCDC23 Adenovirus plasmid
    ORF Viral Vector pGMAP000517 Human CCDC23 Adenovirus plasmid
    ORF Viral Vector pGMPC001860 Human SVBP Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMAP000413 Human CCDC23 Adenovirus particle
    ORF Viral Vector vGMAP000517 Human CCDC23 Adenovirus particle


    Target information

    Target ID GM-SE1327
    Target Name SVBP
    Gene ID 374969, 69216, 698308, 362578, 101094775, 100683368, 614073, 100053543
    Gene Symbol and Synonyms 2410005K17Rik,CCDC23,NEDAHM,RGD1311232,SVBP
    Uniprot Accession Q8N300
    Uniprot Entry Name SVBP_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000177868
    Target Classification Not Available

    Enables microtubule binding activity. Involved in axon development; proteolysis; and regulation of metallopeptidase activity. Acts upstream of or within negative regulation of endothelial cell migration; negative regulation of protein ubiquitination; and protein secretion. Located in apical part of cell. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.