Human HMGB1/HMG-1/HMG1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002128.7)

Cat. No.: pGMPC004728
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HMGB1/HMG-1/HMG1 Non-Viral expression plasmid (overexpression vector) for mouse HMGB1 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to HMGB1/HMG-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC004728
Gene Name HMGB1
Accession Number NM_002128.7
Gene ID 3146
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 648 bp
Gene Alias HMG-1,HMG1,HMG3,SBP-1
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCAAAGGAGATCCTAAGAAGCCGAGAGGCAAAATGTCATCATATGCATTTTTTGTGCAAACTTGTCGGGAGGAGCATAAGAAGAAGCACCCAGATGCTTCAGTCAACTTCTCAGAGTTTTCTAAGAAGTGCTCAGAGAGGTGGAAGACCATGTCTGCTAAAGAGAAAGGAAAATTTGAAGATATGGCAAAAGCGGACAAGGCCCGTTATGAAAGAGAAATGAAAACCTATATCCCTCCCAAAGGGGAGACAAAAAAGAAGTTCAAGGATCCCAATGCACCCAAGAGGCCTCCTTCGGCCTTCTTCCTCTTCTGCTCTGAGTATCGCCCAAAAATCAAAGGAGAACATCCTGGCCTGTCCATTGGTGATGTTGCGAAGAAACTGGGAGAGATGTGGAATAACACTGCTGCAGATGACAAGCAGCCTTATGAAAAGAAGGCTGCGAAGCTGAAGGAAAAATATGAAAAGGATATTGCTGCATATCGAGCTAAAGGAAAGCCTGATGCAGCAAAAAAGGGAGTTGTCAAGGCTGAAAAAAGCAAGAAAAAGAAGGAAGAGGAGGAAGATGAGGAAGATGAAGAGGATGAGGAGGAGGAGGAAGATGAAGAAGATGAAGATGAAGAAGAAGATGATGATGATGAATAA
ORF Protein Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T63595-Ab Anti-HMGB1/ HMG-1/ HMG1 monoclonal antibody
    Target Antigen GM-Tg-g-T63595-Ag HMGB1 VLP (virus-like particle)
    ORF Viral Vector pGMLP001892 Human HMGB1 Lentivirus plasmid
    ORF Viral Vector pGMLV002391 Human HMGB1 Lentivirus plasmid
    ORF Viral Vector pGMAP000070 Human HMGB1 Adenovirus plasmid
    ORF Viral Vector pGMAP000231 Human HMGB1 Adenovirus plasmid
    ORF Viral Vector pGMPC000590 Human HMGB1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC004728 Human HMGB1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP001892 Human HMGB1 Lentivirus particle
    ORF Viral Vector vGMLV002391 Human HMGB1 Lentivirus particle
    ORF Viral Vector vGMAP000070 Human HMGB1 Adenovirus particle
    ORF Viral Vector vGMAP000231 Human HMGB1 Adenovirus particle


    Target information

    Target ID GM-T63595
    Target Name HMGB1
    Gene ID 3146, 15289, 712849, 25459, 101089823, 403170, 282691, 100033873
    Gene Symbol and Synonyms Ac2-008,HMG-1,HMG1,HMG3,HMGB1,p30,SBP-1
    Uniprot Accession P09429
    Uniprot Entry Name HMGB1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Ovary Cancer
    Gene Ensembl ENSG00000189403
    Target Classification Not Available

    This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.