Human HMGB1/HMG3/SBP-1 ORF/cDNA clone-Adenovirus plasmid (BC030981)
Cat. No.: pGMAP000231
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human HMGB1/HMG3/SBP-1 adenoviral expression plasmid for HMGB1 adenovirus packaging, HMGB1 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
HMGB1/HMG3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP000231 |
Gene Name | HMGB1 |
Accession Number | BC030981 |
Gene ID | 3146 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 648 bp |
Gene Alias | HMG3,SBP-1 |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGGGCAAAGGAGATCCTAAGAAGCCGAGAGGCAAAATGTCATCATATGCATTTTTTGTGCAAACTTGTCGGGAGGAGCATAAGAAGAAGCACCCAGATGCTTCAGTCAACTTCTCAGAGTTTTCTAAGAAGTGCTCAGAGAGGTGGAAGACCATGTCTGCTAAAGAGAAAGGAAAATTTGAAGATATGGCAAAAGCGGACAAGGCCCGTTATGAAAGAGAAATGAAAACCTATATCCCTCCCAAAGGGGAGACAAAAAAGAAGTTCAAGGATCCCAATGCACCCAAGAGGCCTCCTTCGGCCTTCTTCCTCTTCTGCTCTGAGTATCGCCCAAAAATCAAAGGAGAACATCCTGGCCTGTCCATTGGTGATGTTGCGAAGAAACTGGGAGAGATGTGGAATAACACTGCTGCAGATGACAAGCAGCCTTATGAAAAGAAGGCTGCGAAGCTGAAGGAAAAATACGAAAAGGATATTGCTGCATATCGAGCTAAAGGAAAGCCTGATGCAGCAAAAAAGGGAGTTGTCAAGGCTGAAAAAAGCAAGAAAAAGAAGGAAGAGGAGGAAGATGAGGAAGATGAAGAGGATGAGGAGGAGGAGGAAGATGAAGAAGATGAAGATGAAGAAGAAGATGATGATGATGAATAA |
ORF Protein Sequence | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T63595-Ab | Anti-HMGB1/ HMG-1/ HMG1 monoclonal antibody |
Target Antigen | GM-Tg-g-T63595-Ag | HMGB1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP001892 | Human HMGB1 Lentivirus plasmid |
ORF Viral Vector | pGMLV002391 | Human HMGB1 Lentivirus plasmid |
ORF Viral Vector | pGMAP000070 | Human HMGB1 Adenovirus plasmid |
ORF Viral Vector | pGMAP000231 | Human HMGB1 Adenovirus plasmid |
ORF Viral Vector | pGMPC000590 | Human HMGB1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC004728 | Human HMGB1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP001892 | Human HMGB1 Lentivirus particle |
ORF Viral Vector | vGMLV002391 | Human HMGB1 Lentivirus particle |
ORF Viral Vector | vGMAP000070 | Human HMGB1 Adenovirus particle |
ORF Viral Vector | vGMAP000231 | Human HMGB1 Adenovirus particle |
Target information
Target ID | GM-T63595 |
Target Name | HMGB1 |
Gene ID | 3146, 15289, 712849, 25459, 101089823, 403170, 282691, 100033873 |
Gene Symbol and Synonyms | Ac2-008,HMG-1,HMG1,HMG3,HMGB1,p30,SBP-1 |
Uniprot Accession | P09429 |
Uniprot Entry Name | HMGB1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Ovary Cancer |
Gene Ensembl | ENSG00000189403 |
Target Classification | Not Available |
This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.