Human HMGB1/HMG3/SBP-1 ORF/cDNA clone-Adenovirus particle (BC003378)

Cat. No.: vGMAP000070

Pre-made Human HMGB1/HMG3/SBP-1 Adenovirus for HMGB1 overexpression in-vitro and in-vivo. The HMGB1 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified HMGB1-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to HMGB1/HMG3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAP000070 Human HMGB1 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAP000070
Gene Name HMGB1
Accession Number BC003378
Gene ID 3146
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 648 bp
Gene Alias HMG3,SBP-1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGGCAAAGGAGATCCTAAGAAGCCGAGAGGCAAAATGTCATCATATGCATTTTTTGTGCAAACTTGTCGGGAGGAGCATAAGAAGAAGCACCCAGATGCTTCAGTCAACTTCTCAGAGTTTTCTAAGAAGTGCTCAGAGAGGTGGAAGACCATGTCTGCTAAAGAGAAAGGAAAATTTGAAGATATGGCAAAGGCGGACAAGGCCCGTTATGAAAGAGAAATGAAAACCTATATCCCTCCCAAAGGGGAGACAAAAAAGAAGTTCAAGGATCCCAATGCACCCAAGAGGCCTCCTTCGGCCTTCTTCCTCTTCTGCTCTGAGTATCGCCCAAAAATCAAAGGAGAACATCCTGGCCTGTCCATTGGTGATGTTGCGAAGAAACTGGGAGAGATGTGGAATAACACTGCTGCAGATGACAAGCAGCCTTATGAAAAGAAGGCTGCGAAGCTGAAGGAAAAATACGAAAAGGATATTGCTGCATATCGAGCTAAAGGAAAGCCTGATGCAGCAAAAAAGGGAGTTGTCAAGGCTGAAAAAAGCAAGAAAAAGAAGGAAGAGGAGGAAGATGAGGAAGATGAAGAGGATGAGGAGGAGGAGGAAGATGAAGAAGATGAAGATGAAGAAGAAGATGATGATGATGAATAA
ORF Protein Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T63595-Ab Anti-HMGB1/ HMG-1/ HMG1 monoclonal antibody
    Target Antigen GM-Tg-g-T63595-Ag HMGB1 VLP (virus-like particle)
    ORF Viral Vector pGMLP001892 Human HMGB1 Lentivirus plasmid
    ORF Viral Vector pGMLV002391 Human HMGB1 Lentivirus plasmid
    ORF Viral Vector pGMAP000070 Human HMGB1 Adenovirus plasmid
    ORF Viral Vector pGMAP000231 Human HMGB1 Adenovirus plasmid
    ORF Viral Vector pGMPC000590 Human HMGB1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC004728 Human HMGB1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP001892 Human HMGB1 Lentivirus particle
    ORF Viral Vector vGMLV002391 Human HMGB1 Lentivirus particle
    ORF Viral Vector vGMAP000070 Human HMGB1 Adenovirus particle
    ORF Viral Vector vGMAP000231 Human HMGB1 Adenovirus particle


    Target information

    Target ID GM-T63595
    Target Name HMGB1
    Gene ID 3146, 15289, 712849, 25459, 101089823, 403170, 282691, 100033873
    Gene Symbol and Synonyms Ac2-008,HMG-1,HMG1,HMG3,HMGB1,p30,SBP-1
    Uniprot Accession P09429
    Uniprot Entry Name HMGB1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Ovary Cancer
    Gene Ensembl ENSG00000189403
    Target Classification Not Available

    This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.