Human BNIP3/NIP3 ORF/cDNA clone-Adenovirus particle (NM_004052.3)

Cat. No.: vGMAD000162

Pre-made Human BNIP3/NIP3 Adenovirus for BNIP3 overexpression in-vitro and in-vivo. The BNIP3 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified BNIP3-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to BNIP3/NIP3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000162 Human BNIP3 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000162
Gene Name BNIP3
Accession Number NM_004052.3
Gene ID 664
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 780 bp
Gene Alias NIP3
Fluorescent Reporter YFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCGACGCGGCCGCAGATCCGCCCGGCCCCGCCCTGCCCTGTGAGTTCCTCCGGCCGGGCTGCGGGGCTCCGCTCAGTCCGGGAGCGCAGCTGGGCCGCGGCGCTCCGACCTCCGCTTTCCCACCGCCCGCAGCTGAAGCACATCCCGCAGCCCGGCGCGGACTCCGATCGCCGCAGTTGCCCTCTGGCGCCATGTCGCAGAACGGAGCGCCCGGGATGCAGGAGGAGAGCCTGCAGGGCTCCTGGGTAGAACTGCACTTCAGCAATAATGGGAACGGGGGCAGCGTTCCAGCCTCGGTTTCTATTTATAATGGAGACATGGAAAAAATACTGCTGGACGCACAGCATGAGTCTGGACGGAGTAGCTCCAAGAGCTCTCACTGTGACAGCCCACCTCGCTCGCAGACACCACAAGATACCAACAGAGCTTCTGAAACAGATACCCATAGCATTGGAGAGAAAAACAGCTCACAGTCTGAGGAAGATGATATTGAAAGAAGGAAAGAAGTTGAAAGCATCTTGAAGAAAAACTCAGATTGGATATGGGATTGGTCAAGTCGGCCGGAAAATATTCCCCCCAAGGAGTTCCTCTTTAAACACCCGAAGCGCACGGCCACCCTCAGCATGAGGAACACGAGCGTCATGAAGAAAGGGGGCATATTCTCTGCAGAATTTCTGAAAGTTTTCCTTCCATCTCTGCTGCTCTCTCATTTGCTGGCCATCGGATTGGGGATCTATATTGGAAGGCGTCTGACAACCTCCACCAGCACCTTTTGA
ORF Protein Sequence MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0426-Ab Anti-BNIP3 monoclonal antibody
    Target Antigen GM-Tg-g-IP0426-Ag BNIP3 protein
    ORF Viral Vector pGMLV001131 Human BNIP3 Lentivirus plasmid
    ORF Viral Vector pGMAD000162 Human BNIP3 Adenovirus plasmid
    ORF Viral Vector pGMLPm004024 Human BNIP3 Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-116 Human BNIP3 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-256 Human BNIP3 Adenovirus plasmid
    ORF Viral Vector pGMPC000183 Human bnip3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV001131 Human BNIP3 Lentivirus particle
    ORF Viral Vector vGMAD000162 Human BNIP3 Adenovirus particle
    ORF Viral Vector vGMLPm004024 Human BNIP3 Lentivirus particle
    ORF Viral Vector vGMLP-SPh-116 Human BNIP3 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-256 Human BNIP3 Adenovirus particle


    Target information

    Target ID GM-IP0426
    Target Name BNIP3
    Gene ID 664, 12176, 100426120, 84480, 768094, 607408, 615342, 100051673
    Gene Symbol and Synonyms BNIP3,HABON,NIP3
    Uniprot Accession Q12983
    Uniprot Entry Name BNIP3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000176171
    Target Classification Tumor-associated antigen (TAA)

    This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methylation. [provided by RefSeq, Dec 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.