Human CAV3/LGMD1C/LQT9 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_033337.2)
Cat. No.: pGMAAV000425
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CAV3/LGMD1C/LQT9 Adeno-associated virus expression plasmid (ITR-vector) for CAV3 AAV packaging, CAV3 AAV production.The purified Human CAV3/LGMD1C/LQT9 AAV particle serves as an invaluable asset for in-depth in vivo CAV3 studies, mechanism of action (MOA) research, and the evolution of CAV3-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Go to
CAV3/LGMD1C products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAAV000425 |
Gene Name | CAV3 |
Accession Number | NM_033337.2 |
Gene ID | 859 |
Species | Human |
Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
Insert Length | 456 bp |
Gene Alias | LGMD1C,LQT9,MPDT,RMD2,VIP-21,VIP21 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | cTNT |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGATGGCAGAAGAGCACACAGATCTCGAGGCCCAGATCGTCAAGGATATCCACTGCAAGGAGATTGACCTGGTGAACCGAGACCCCAAGAACATTAACGAGGACATAGTCAAGGTGGATTTTGAAGACGTGATCGCAGAGCCTGTGGGCACCTACAGCTTTGACGGCGTGTGGAAGGTGAGCTACACCACCTTCACTGTCTCCAAGTACTGGTGCTACCGTCTGTTGTCCACGCTGCTGGGCGTCCCACTGGCCCTGCTCTGGGGCTTCCTGTTCGCCTGCATCTCCTTCTGCCACATCTGGGCGGTGGTGCCATGCATTAAGAGCTACCTGATCGAGATCCAGTGCATCAGCCACATCTACTCACTCTGCATCCGCACCTTCTGCAACCCACTCTTCGCGGCCCTGGGCCAGGTCTGCAGCAGCATCAAGGTGGTGCTGCGGAAGGAGGTCTAA |
ORF Protein Sequence | MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0187-Ab | Anti-CAV3/ LGMD1C/ LQT9 monoclonal antibody |
Target Antigen | GM-Tg-g-MP0187-Ag | CAV3 VLP (virus-like particle) |
ORF Viral Vector | pGMLP002892 | Human CAV3 Lentivirus plasmid |
ORF Viral Vector | pGMAAV000425 | Human CAV3 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | pGMPC000372 | Human CAV3 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP002892 | Human CAV3 Lentivirus particle |
ORF Viral Vector | vGMAAV000425 | Human CAV3 Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-MP0187 |
Target Name | CAV3 |
Gene ID | 859, 12391, 702163, 29161, 101081453, 484671, 615310, 100058881 |
Gene Symbol and Synonyms | Cav-3,CAV3,LGMD1C,LQT9,M-cav,MPDT,RMD2,VIP-21,VIP21 |
Uniprot Accession | P56539 |
Uniprot Entry Name | CAV3_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000182533 |
Target Classification | Not Available |
This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.