Human MSRA/PMSR ORF/cDNA clone-Adenovirus plasmid (NM_012331)
Cat. No.: pGMAD001617
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MSRA/PMSR adenoviral expression plasmid for MSRA adenovirus packaging, MSRA adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
MSRA/PMSR products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAD001617 |
Gene Name | MSRA |
Accession Number | NM_012331 |
Gene ID | 4482 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 708 bp |
Gene Alias | PMSR |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGCTCTCGGCCACCCGGAGGGCTTGCCAGCTCCTCCTCCTCCACAGCCTCTTTCCCGTCCCGAGGATGGGCAACTCGGCCTCGAACATCGTCAGCCCCCAGGAGGCCTTGCCGGGCCGGAAGGAACAGACCCCTGTAGCGGCCAAACATCATGTCAATGGCAACAGAACAGTCGAACCTTTCCCAGAGGGAACACAGATGGCTGTATTTGGAATGGGATGTTTCTGGGGAGCTGAAAGGAAATTCTGGGTCTTGAAAGGAGTGTATTCAACTCAAGTTGGTTTTGCAGGAGGCTATACTTCAAATCCTACTTATAAAGAAGTCTGCTCAGAAAAAACTGGCCATGCAGAAGTCGTCCGAGTGGTGTACCAGCCAGAACACATGAGTTTTGAGGAACTGCTCAAGGTCTTCTGGGAGAATCACGACCCGACCCAAGGTATGCGCCAGGGGAACGACCATGGCACTCAGTACCGCTCGGCCATCTACCCGACCTCTGCCAAGCAAATGGAGGCAGCCCTGAGCTCCAAAGAGAACTACCAAAAGGTTCTTTCAGAGCACGGCTTCGGCCCCATCACTACCGACATCCGGGAGGGACAGACTTTCTACTATGCGGAAGACTACCACCAGCAGTACCTGAGCAAGAACCCCAATGGCTACTGCGGCCTTGGGGGCACCGGCGTGTCCTGCCCAGTGGGTATTAAAAAATAA |
ORF Protein Sequence | MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP2600-Ab | Anti-MSRA/ PMSR monoclonal antibody |
Target Antigen | GM-Tg-g-MP2600-Ag | MSRA VLP (virus-like particle) |
ORF Viral Vector | pGMLP000029 | Human MSRA Lentivirus plasmid |
ORF Viral Vector | pGMAD001617 | Human MSRA Adenovirus plasmid |
ORF Viral Vector | vGMLP000029 | Human MSRA Lentivirus particle |
ORF Viral Vector | vGMAD001617 | Human MSRA Adenovirus particle |
Target information
Target ID | GM-MP2600 |
Target Name | MSRA |
Gene ID | 4482, 110265, 698628, 29447, 101082232, 608103, 281312, 100061773 |
Gene Symbol and Synonyms | 2310045J23Rik,6530413P12Rik,MSR-A,MSRA,PMSR |
Uniprot Accession | Q9UJ68 |
Uniprot Entry Name | MSRA_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Prostate Cancer |
Gene Ensembl | ENSG00000175806 |
Target Classification | Not Available |
This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.