Human CLDN7/CEPTRL2/claudin-1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001307)

Cat. No.: pGMPC000063
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CLDN7/CEPTRL2/claudin-1 Non-Viral expression plasmid (overexpression vector) for mouse CLDN7 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to CLDN7/CEPTRL2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000063
Gene Name CLDN7
Accession Number NM_001307
Gene ID 1366
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 636 bp
Gene Alias CEPTRL2,claudin-1,CLDN-7,CPETRL2,Hs.84359
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCAATTCGGGCCTGCAGTTGCTGGGCTTCTCCATGGCCCTGCTGGGCTGGGTGGGTCTGGTGGCCTGCACCGCCATCCCGCAGTGGCAGATGAGCTCCTATGCGGGTGACAACATCATCACGGCCCAGGCCATGTACAAGGGGCTGTGGATGGACTGCGTCACGCAGAGCACGGGGATGATGAGCTGCAAAATGTACGACTCGGTGCTCGCCCTGTCCGCGGCCTTGCAGGCCACTCGAGCCCTAATGGTGGTCTCCCTGGTGCTGGGCTTCCTGGCCATGTTTGTGGCCACGATGGGCATGAAGTGCACGCGCTGTGGGGGAGACGACAAAGTGAAGAAGGCCCGTATAGCCATGGGTGGAGGCATAATTTTCATCGTGGCAGGTCTTGCCGCCTTGGTAGCTTGCTCCTGGTATGGCCATCAGATTGTCACAGACTTTTATAACCCTTTGATCCCTACCAACATTAAGTATGAGTTTGGCCCTGCCATCTTTATTGGCTGGGCAGGGTCTGCCCTAGTCATCCTGGGAGGTGCACTGCTCTCCTGTTCCTGTCCTGGGAATGAGAGCAAGGCTGGGTACCGTGTACCCCGCTCTTACCCTAAGTCCAACTCTTCCAAGGAGTATGTGTGA
ORF Protein Sequence MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0286-Ab Anti-CLD7/ CLDN7/ CEPTRL2 monoclonal antibody
    Target Antigen GM-Tg-g-MP0286-Ag CLDN7 VLP (virus-like particle)
    ORF Viral Vector pGMLP000382 Human CLDN7 Lentivirus plasmid
    ORF Viral Vector pGMAP000040 Human CLDN7 Adenovirus plasmid
    ORF Viral Vector pGMAP000104 Human CLDN7 Adenovirus plasmid
    ORF Viral Vector pGMPC000063 Human CLDN7 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000382 Human CLDN7 Lentivirus particle
    ORF Viral Vector vGMAP000040 Human CLDN7 Adenovirus particle
    ORF Viral Vector vGMAP000104 Human CLDN7 Adenovirus particle


    Target information

    Target ID GM-MP0286
    Target Name CLDN7
    Gene ID 1366, 53624, 714647, 65132, 101096019, 489466, 512975, 100072960
    Gene Symbol and Synonyms CEPTRL2,claudin-1,cld-7,CLDN-7,CLDN7,CPETRL2,Hs.84359
    Uniprot Accession O95471
    Uniprot Entry Name CLD7_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000181885
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.