Human CLDN7/claudin-1/Hs.84359 ORF/cDNA clone-Adenovirus plasmid (BC001055.2)
Cat. No.: pGMAP000104
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CLDN7/claudin-1/Hs.84359 adenoviral expression plasmid for CLDN7 adenovirus packaging, CLDN7 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
CLDN7/claudin-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP000104 |
Gene Name | CLDN7 |
Accession Number | BC001055.2 |
Gene ID | 1366 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 636 bp |
Gene Alias | claudin-1,Hs.84359 |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGGCCAATTCGGGCCTGCAGTTGCTGGGCTTCTCCATGGCCCTGCTGGGCTGGGTGGGTCTGGTGGCCTGCACCGCCATCCCGCAGTGGCAGATGAGCTCCTATGCGGGTGACAACATCATCACGGCCCAGGCCATGTACAAGGGGCTGTGGATGGACTGCGTCACGCAGAGCACGGGGATGATGAGCTGCAAAATGTACGACTCGGTGCTCGCCCTGTCCGCGGCCTTGCAGGCCACTCGAGCCCTAATGGTGGTCTCCCTGGTGCTGGGCTTCCTGGCCATGTTTGTGGCCACGATGGGCATGAAGTGCACGCGCTGTGGGGGAGACGACAAAGTGAAGAAGGCCCGTATAGCCATGGGTGGAGGCATAATTTTCATCGTGGCAGGTCTTGCCACCTTGGTAGCTTGCTCCTGGTATGGCCATCAGATTGTCACAGACTTTTATAACCCTTTGATCCCTACCAACATTAAGTATGAGTTTGGCCCTGCCATCTTTATTGGCTGGGCAGGGTCTGCCCTAGTCATCCTGGGAGGTGCACTGCTCTCCTGTTCCTGTCCTGGGAATGAGAGCAAGGCTGGGTACCGTGCACCCCGCTCTTACCCTAAGTCCAACTCTTCCAAGGAGTATGTGTGA |
ORF Protein Sequence | MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0286-Ab | Anti-CLD7/ CLDN7/ CEPTRL2 monoclonal antibody |
Target Antigen | GM-Tg-g-MP0286-Ag | CLDN7 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000382 | Human CLDN7 Lentivirus plasmid |
ORF Viral Vector | pGMAP000040 | Human CLDN7 Adenovirus plasmid |
ORF Viral Vector | pGMAP000104 | Human CLDN7 Adenovirus plasmid |
ORF Viral Vector | pGMPC000063 | Human CLDN7 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000382 | Human CLDN7 Lentivirus particle |
ORF Viral Vector | vGMAP000040 | Human CLDN7 Adenovirus particle |
ORF Viral Vector | vGMAP000104 | Human CLDN7 Adenovirus particle |
Target information
Target ID | GM-MP0286 |
Target Name | CLDN7 |
Gene ID | 1366, 53624, 714647, 65132, 101096019, 489466, 512975, 100072960 |
Gene Symbol and Synonyms | CEPTRL2,claudin-1,cld-7,CLDN-7,CLDN7,CPETRL2,Hs.84359 |
Uniprot Accession | O95471 |
Uniprot Entry Name | CLD7_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Cancer |
Gene Ensembl | ENSG00000181885 |
Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, May 2010]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.