Human IL3RA/CD123/hIL-3Ra ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002183.4)

Cat. No.: pGMPC004785
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL3RA/CD123/hIL-3Ra Non-Viral expression plasmid (overexpression vector) for mouse IL3RA overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL3RA/CD123 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC004785
Gene Name IL3RA
Accession Number NM_002183.4
Gene ID 3563
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 1137 bp
Gene Alias CD123,hIL-3Ra,IL-3R-alpha,IL3R,IL3RAY,IL3RX,IL3RY
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCCTCCTTTGGCTCACGCTGCTCCTGATCGCCCTGCCCTGTCTCCTGCAAACGAAGGAAGATCCAAACCCACCAATCACGAACCTAAGGATGAAAGCAAAGGCTCAGCAGTTGACCTGGGACCTTAACAGAAATGTGACCGATATCGAGTGTGTTAAAGACGCCGACTATTCTATGCCGGCAGTGAACAATAGCTATTGCCAGTTTGGAGCAATTTCCTTATGTGAAGTGACCAACTACACCGTCCGAGTGGCCAACCCACCATTCTCCACGTGGATCCTCTTCCCTGAGAACAGTGGGAAGCCTTGGGCAGGTGCGGAGAATCTGACCTGCTGGATTCATGACGTGGATTTCTTGAGCTGCAGCTGGGCGGTAGGCCCGGGGGCCCCCGCGGACGTCCAGTACGACCTGTACTTGAACGTTGCCAACAGGCGTCAACAGTACGAGTGTCTTCACTACAAAACGGATGCTCAGGGAACACGTATCGGGTGTCGTTTCGATGACATCTCTCGACTCTCCAGCGGTTCTCAAAGTTCCCACATCCTGGTGCGGGGCAGGAGCGCAGCCTTCGGTATCCCCTGCACAGATAAGTTTGTCGTCTTTTCACAGATTGAGATATTAACTCCACCCAACATGACTGCAAAGTGTAATAAGACACATTCCTTTATGCACTGGAAAATGAGAAGTCATTTCAATCGCAAATTTCGCTATGAGCTTCAGATACAAAAGAGAATGCAGCCTGTAATCACAGAACAGGTCAGAGACAGAACCTCCTTCCAGCTACTCAATCCTGGAACGTACACAGTACAAATAAGAGCCCGGGAAAGAGTGTATGAATTCTTGAGCGCCTGGAGCACCCCCCAGCGCTTCGAGTGCGACCAGGAGGAGGGCGCAAACACACGTGCCTGGCGGACGTCGCTGCTGATCGCGCTGGGGACGCTGCTGGCCCTGGTCTGTGTCTTCGTGATCTGCAGAAGGTATCTGGTGATGCAGAGACTCTTTCCCCGCATCCCTCACATGAAAGACCCCATCGGTGACAGCTTCCAAAACGACAAGCTGGTGGTCTGGGAGGCGGGCAAAGCCGGCCTGGAGGAGTGTCTGGTGACTGAAGTACAGGTCGTGCAGAAAACTTGA
ORF Protein Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-545 Pre-Made Talacotuzumab biosimilar, Whole mAb, Anti-IL3RA Antibody: Anti-IL3R/CD123/IL3RX/IL3RY/hIL-3Ra therapeutic antibody
    Biosimilar GMP-Bios-ab-686 Pre-Made Pivekimab biosimilar, Whole mAb, Anti-IL3RA Antibody: Anti-IL3R/CD123/IL3RX/IL3RY/hIL-3Ra therapeutic antibody
    Biosimilar GMP-Bios-ab-619 Pre-Made Vibecotamab biosimilar, Bispecific Mixed mAb and scFv, Anti-IL3RA;CD3E Antibody: Anti-CD123/IL3RX/IL3RY/IL3RAY/hIL-3Ra;T3E/TCRE/IMD18 therapeutic antibody
    Biosimilar GMP-Bios-INN-961 Pre-Made Pivekimab Sunirine Biosimilar, Whole Mab Adc, Anti-Il3Ra Antibody: Anti-CD123/IL3R/IL3RX/IL3RY/hIL-3Ra therapeutic antibody Drug Conjugate
    Biosimilar GMP-Bios-ab-218 Pre-Made Flotetuzumab biosimilar, Bispecific scFv with Crossover, Anti-IL3RA;CD3E Antibody: Anti-CD123/IL3RX/IL3RY/IL3RAY/hIL-3Ra;T3E/TCRE/IMD18 therapeutic antibody
    Target Antibody GM-Tg-g-T71377-Ab Anti-IL3RA/ CD123/ IL3RY monoclonal antibody
    Target Antigen GM-Tg-g-T71377-Ag IL3RA VLP (virus-like particle)
    ORF Viral Vector pGMPC004785 Human IL3RA Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-T71377
    Target Name IL3RA
    Gene ID 3563, 106995138, 246144, 105261394, 609293, 100299249
    Gene Symbol and Synonyms CD123,Cyrl,hIL-3Ra,IL-3R-alpha,IL3R,IL3RA,IL3RAY,IL3RX,IL3RY
    Uniprot Accession P26951
    Uniprot Entry Name IL3RA_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease Not Available
    Gene Ensembl ENSG00000185291
    Target Classification Checkpoint-Immuno Oncology

    The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. Alternatively spliced transcript variants encoding distinct isoforms have been found. [provided by RefSeq, Jun 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.