Mouse Il17f/C87042/IL-17F ORF/cDNA clone-Adenovirus plasmid (NM_145856)

Cat. No.: pGMAP-IL-149
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Mouse Il17f/C87042/IL-17F adenoviral expression plasmid for Il17f adenovirus packaging, Il17f adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-IL-149
Gene Name Il17f
Accession Number NM_145856
Gene ID 257630
Species Mouse
Product Type Adenovirus plasmid (overexpression)
Insert Length 486 bp
Gene Alias C87042,IL-17F
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAAGTGCACCCGTGAAACAGCCATGGTCAAGTCTTTGCTACTGTTGATGTTGGGACTTGCCATTCTGAGGGAGGTAGCAGCTCGGAAGAACCCCAAAGCAGGGGTTCCTGCCTTGCAGAAGGCTGGGAACTGTCCTCCCCTGGAGGATAACACTGTGAGAGTTGACATTCGAATCTTCAACCAAAACCAGGGCATTTCTGTCCCACGTGAATTCCAGAACCGCTCCAGTTCCCCATGGGATTACAACATCACTCGAGACCCCCACCGGTTCCCCTCAGAGATCGCTGAGGCCCAGTGCAGACACTCAGGCTGCATCAATGCCCAGGGTCAGGAAGACAGCACCATGAACTCCGTCGCCATTCAGCAAGAAATCCTGGTCCTTCGGAGGGAGCCCCAGGGCTGTTCTAATTCCTTCAGGTTGGAGAAGATGCTCCTAAAAGTTGGCTGCACCTGTGTCAAGCCCATTGTCCACCAAGCGGCCTGA
ORF Protein Sequence MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector vGMAP-IL-149 Mouse Il17f Adenovirus particle




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.